-
Notifications
You must be signed in to change notification settings - Fork 8
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Merge branch 'development' into feature/timsTOF
- Loading branch information
Showing
17 changed files
with
122 additions
and
21 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
|
@@ -15,5 +15,5 @@ full_name: Victor Giurcoiu | |
email: [email protected] | ||
project_name: oktoberfest | ||
project_short_description: Public repo oktoberfest | ||
version: 0.5.0 | ||
version: 0.5.1 | ||
license: MIT |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,8 +1,14 @@ | ||
name: Run oktoberfest Tests | ||
|
||
on: | ||
- push | ||
- pull_request | ||
push: | ||
branches: | ||
- development | ||
- main | ||
- "release/*" | ||
pull_request: | ||
branches: | ||
- "*" | ||
|
||
jobs: | ||
tests: | ||
|
@@ -63,7 +69,7 @@ jobs: | |
|
||
steps: | ||
- name: Check out the repository | ||
uses: actions/checkout@v2.3.4 | ||
uses: actions/checkout@v4 | ||
|
||
- name: Set up Python ${{ matrix.python-version }} | ||
uses: actions/setup-python@v4 | ||
|
@@ -98,7 +104,7 @@ jobs: | |
print("::set-output name=result::{}".format(result)) | ||
- name: Restore pre-commit cache | ||
uses: actions/[email protected].1 | ||
uses: actions/[email protected].2 | ||
if: matrix.session == 'pre-commit' | ||
with: | ||
path: ~/.cache/pre-commit | ||
|
@@ -128,7 +134,7 @@ jobs: | |
needs: tests | ||
steps: | ||
- name: Check out the repository | ||
uses: actions/checkout@v3 | ||
uses: actions/checkout@v4 | ||
|
||
- name: Set up Python 3.8 | ||
uses: actions/setup-python@v4 | ||
|
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,6 +1,6 @@ | ||
[tool.poetry] | ||
name = "oktoberfest" | ||
version = "0.5.0" # <<COOKIETEMPLE_FORCE_BUMP>> | ||
version = "0.5.1" # <<COOKIETEMPLE_FORCE_BUMP>> | ||
description = "Public repo oktoberfest" | ||
authors = ["Victor Giurcoiu <[email protected]>"] | ||
license = "MIT" | ||
|
26 changes: 26 additions & 0 deletions
26
tests/unit_tests/configs/spectral_library_with_digest.json
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,26 @@ | ||
{ | ||
"type": "SpectralLibraryGeneration", | ||
"tag": "", | ||
"inputs": { | ||
"library_input": "../data/test.fasta", | ||
"library_input_type": "fasta" | ||
}, | ||
"output": "../data/", | ||
"models": { | ||
"intensity": "Prosit_2020_intensity_HCD", | ||
"irt": "Prosit_2019_irt" | ||
}, | ||
"outputFormat": "spectronaut", | ||
"prediction_server": "koina.proteomicsdb.org:443", | ||
"ssl": true, | ||
"fastaDigestOptions": { | ||
"fragmentation": "HCD", | ||
"digestion": "full", | ||
"missedCleavages": 2, | ||
"minLength": 7, | ||
"maxLength": 60, | ||
"enzyme": "trypsin", | ||
"specialAas": "KR", | ||
"db": "concat" | ||
} | ||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,54 @@ | ||
>ENSP00000488551.1 pep:known chromosome:GRCh38:CHR_HSCHR7_2_CTG6:142634764:142635309:1 gene:ENSG00000282497.1 transcript:ENST00000631835.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGPGLLHWMALCLLGTGHGDAMVIQNPRYQVTQFGKPVTLSCSQTLNHNVMYWYQQKSSQ | ||
APKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSR | ||
>ENSP00000374917.3 pep:known chromosome:GRCh38:7:142626649:142627399:1 gene:ENSG00000211747.3 transcript:ENST00000390394.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MLLLLLLLGPGSGLGAVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLML | ||
MATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR | ||
>ENSP00000374919.1 pep:known chromosome:GRCh38:7:142645961:142646467:1 gene:ENSG00000211749.1 transcript:ENST00000390396.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGTRLLGCAALCLLAADSFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNK | ||
EFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ | ||
>ENSP00000452526.1 pep:known chromosome:GRCh38:14:22052514:22053056:1 gene:ENSG00000211801.3 transcript:ENST00000390449.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
METLLGLLILWLQLQWVSSKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPG | ||
KGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR | ||
>ENSP00000437362.1 pep:known chromosome:GRCh38:14:21887857:21888502:1 gene:ENSG00000211789.2 transcript:ENST00000390437.2 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQY | ||
SGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN | ||
>ENSP00000374895.3 pep:known chromosome:GRCh38:7:142482548:142483019:1 gene:ENSG00000211725.3 transcript:ENST00000390372.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGPGLLCWVLLCLLGAGPVDAGVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQ | ||
GPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL | ||
>ENSP00000488152.1 pep:known chromosome:GRCh38:CHR_HSCHR7_2_CTG6:142374511:142375050:1 gene:ENSG00000282506.1 transcript:ENST00000631392.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGTRLLFWVAFCLLGADHTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQ | ||
GLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL | ||
>ENSP00000446355.1 pep:known chromosome:GRCh38:14:21749178:21749705:1 gene:ENSG00000211779.3 transcript:ENST00000390427.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MKTFAGFSFLFLWLQLDCMSRGEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEP | ||
GAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES | ||
>ENSP00000479506.1 pep:known chromosome:GRCh38:7:142580917:142581427:1 gene:ENSG00000275158.1 transcript:ENST00000621184.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MATRLLCCVVLCLLGEELIDARVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQ | ||
GLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL | ||
>ENSP00000374920.2 pep:known chromosome:GRCh38:7:142656701:142657213:1 gene:ENSG00000211750.2 transcript:ENST00000390397.2 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGL | ||
GLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL | ||
>ENSP00000374884.3 pep:known chromosome:GRCh38:7:142384329:142384841:1 gene:ENSG00000211714.3 transcript:ENST00000390361.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGTRLLCWAALCLLGADHTGAGVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQ | ||
GPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL | ||
>ENSP00000480999.1 pep:known chromosome:GRCh38:7:142563740:142564245:1 gene:ENSG00000276953.1 transcript:ENST00000617347.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGSWTLCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMR | ||
GLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL | ||
>ENSP00000479267.1 pep:known chromosome:GRCh38:7:142544212:142544685:1 gene:ENSG00000275791.1 transcript:ENST00000611462.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MGTRLFFYVALCLLWTGHMDAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGH | ||
GLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE | ||
>ENSP00000477916.1 pep:known chromosome:GRCh38:7:142560423:142560931:1 gene:ENSG00000274752.1 transcript:ENST00000620569.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMR | ||
GLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL | ||
>ENSP00000451535.1 pep:known chromosome:GRCh38:14:21736152:21736982:1 gene:ENSG00000211778.2 transcript:ENST00000390426.2 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MRQVARVIVFLTLSTLSLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQG | ||
PRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD | ||
>ENSP00000451822.1 pep:known chromosome:GRCh38:14:21965451:21966061:1 gene:ENSG00000211794.3 transcript:ENST00000390442.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MMKSLRVLLVILWLQLSWVWSQQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQ | ||
YSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS | ||
>ENSP00000450505.1 pep:known chromosome:GRCh38:14:21978459:21979120:1 gene:ENSG00000211795.3 transcript:ENST00000390443.3 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MLLLLVPAFQVIFTLGGTRAQSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPN | ||
QGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS | ||
>ENSP00000451359.1 pep:known chromosome:GRCh38:14:21990496:21990938:1 gene:ENSG00000211796.1 transcript:ENST00000390444.1 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene | ||
MKPTLISVLVIIFILRGTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYSR | ||
QRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,15 @@ | ||
import unittest | ||
from pathlib import Path | ||
from unittest.mock import patch | ||
|
||
from oktoberfest.__main__ import main | ||
|
||
|
||
class TestRunner(unittest.TestCase): | ||
"""Test class for use cases of runner.""" | ||
|
||
def test_speclib_digest(self): | ||
"""Test the runner for a spectral library generation with a fasta digest.""" | ||
config_path = Path(__file__).parent / "configs" / "spectral_library_with_digest.json" | ||
with patch("sys.argv", ["oktoberfest", f"--config_path={config_path}"]): | ||
main() |