+const SchemaURL = "https://opentelemetry.io/schemas/1.21.0"
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.21.0/trace.go b/vendor/go.opentelemetry.io/otel/semconv/v1.21.0/trace.go
new file mode 100644
index 000000000..b5a91450d
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.21.0/trace.go
@@ -0,0 +1,2495 @@
+// Copyright The OpenTelemetry Authors
+//
+// Licensed under the Apache License, Version 2.0 (the "License");
+// you may not use this file except in compliance with the License.
+// You may obtain a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS,
+// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+// See the License for the specific language governing permissions and
+// limitations under the License.
+
+// Code generated from semantic convention specification. DO NOT EDIT.
+
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.21.0"
+
+import "go.opentelemetry.io/otel/attribute"
+
+// The shared attributes used to report a single exception associated with a
+// span or log.
+const (
+ // ExceptionTypeKey is the attribute Key conforming to the "exception.type"
+ // semantic conventions. It represents the type of the exception (its
+ // fully-qualified class name, if applicable). The dynamic type of the
+ // exception should be preferred over the static type in languages that
+ // support it.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'java.net.ConnectException', 'OSError'
+ ExceptionTypeKey = attribute.Key("exception.type")
+
+ // ExceptionMessageKey is the attribute Key conforming to the
+ // "exception.message" semantic conventions. It represents the exception
+ // message.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Division by zero', "Can't convert 'int' object to str
+ // implicitly"
+ ExceptionMessageKey = attribute.Key("exception.message")
+
+ // ExceptionStacktraceKey is the attribute Key conforming to the
+ // "exception.stacktrace" semantic conventions. It represents a stacktrace
+ // as a string in the natural representation for the language runtime. The
+ // representation is to be determined and documented by each language SIG.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Exception in thread "main" java.lang.RuntimeException: Test
+ // exception\\n at '
+ // 'com.example.GenerateTrace.methodB(GenerateTrace.java:13)\\n at '
+ // 'com.example.GenerateTrace.methodA(GenerateTrace.java:9)\\n at '
+ // 'com.example.GenerateTrace.main(GenerateTrace.java:5)'
+ ExceptionStacktraceKey = attribute.Key("exception.stacktrace")
+)
+
+// ExceptionType returns an attribute KeyValue conforming to the
+// "exception.type" semantic conventions. It represents the type of the
+// exception (its fully-qualified class name, if applicable). The dynamic type
+// of the exception should be preferred over the static type in languages that
+// support it.
+func ExceptionType(val string) attribute.KeyValue {
+ return ExceptionTypeKey.String(val)
+}
+
+// ExceptionMessage returns an attribute KeyValue conforming to the
+// "exception.message" semantic conventions. It represents the exception
+// message.
+func ExceptionMessage(val string) attribute.KeyValue {
+ return ExceptionMessageKey.String(val)
+}
+
+// ExceptionStacktrace returns an attribute KeyValue conforming to the
+// "exception.stacktrace" semantic conventions. It represents a stacktrace as a
+// string in the natural representation for the language runtime. The
+// representation is to be determined and documented by each language SIG.
+func ExceptionStacktrace(val string) attribute.KeyValue {
+ return ExceptionStacktraceKey.String(val)
+}
+
+// Span attributes used by AWS Lambda (in addition to general `faas`
+// attributes).
+const (
+ // AWSLambdaInvokedARNKey is the attribute Key conforming to the
+ // "aws.lambda.invoked_arn" semantic conventions. It represents the full
+ // invoked ARN as provided on the `Context` passed to the function
+ // (`Lambda-Runtime-Invoked-Function-ARN` header on the
+ // `/runtime/invocation/next` applicable).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'arn:aws:lambda:us-east-1:123456:function:myfunction:myalias'
+ // Note: This may be different from `cloud.resource_id` if an alias is
+ // involved.
+ AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn")
+)
+
+// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the
+// "aws.lambda.invoked_arn" semantic conventions. It represents the full
+// invoked ARN as provided on the `Context` passed to the function
+// (`Lambda-Runtime-Invoked-Function-ARN` header on the
+// `/runtime/invocation/next` applicable).
+func AWSLambdaInvokedARN(val string) attribute.KeyValue {
+ return AWSLambdaInvokedARNKey.String(val)
+}
+
+// Attributes for CloudEvents. CloudEvents is a specification on how to define
+// event data in a standard way. These attributes can be attached to spans when
+// performing operations with CloudEvents, regardless of the protocol being
+// used.
+const (
+ // CloudeventsEventIDKey is the attribute Key conforming to the
+ // "cloudevents.event_id" semantic conventions. It represents the
+ // [event_id](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id)
+ // uniquely identifies the event.
+ //
+ // Type: string
+ // RequirementLevel: Required
+ // Stability: stable
+ // Examples: '123e4567-e89b-12d3-a456-426614174000', '0001'
+ CloudeventsEventIDKey = attribute.Key("cloudevents.event_id")
+
+ // CloudeventsEventSourceKey is the attribute Key conforming to the
+ // "cloudevents.event_source" semantic conventions. It represents the
+ // [source](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1)
+ // identifies the context in which an event happened.
+ //
+ // Type: string
+ // RequirementLevel: Required
+ // Stability: stable
+ // Examples: 'https://github.com/cloudevents',
+ // '/cloudevents/spec/pull/123', 'my-service'
+ CloudeventsEventSourceKey = attribute.Key("cloudevents.event_source")
+
+ // CloudeventsEventSpecVersionKey is the attribute Key conforming to the
+ // "cloudevents.event_spec_version" semantic conventions. It represents the
+ // [version of the CloudEvents
+ // specification](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion)
+ // which the event uses.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '1.0'
+ CloudeventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version")
+
+ // CloudeventsEventTypeKey is the attribute Key conforming to the
+ // "cloudevents.event_type" semantic conventions. It represents the
+ // [event_type](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type)
+ // contains a value describing the type of event related to the originating
+ // occurrence.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'com.github.pull_request.opened',
+ // 'com.example.object.deleted.v2'
+ CloudeventsEventTypeKey = attribute.Key("cloudevents.event_type")
+
+ // CloudeventsEventSubjectKey is the attribute Key conforming to the
+ // "cloudevents.event_subject" semantic conventions. It represents the
+ // [subject](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject)
+ // of the event in the context of the event producer (identified by
+ // source).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'mynewfile.jpg'
+ CloudeventsEventSubjectKey = attribute.Key("cloudevents.event_subject")
+)
+
+// CloudeventsEventID returns an attribute KeyValue conforming to the
+// "cloudevents.event_id" semantic conventions. It represents the
+// [event_id](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id)
+// uniquely identifies the event.
+func CloudeventsEventID(val string) attribute.KeyValue {
+ return CloudeventsEventIDKey.String(val)
+}
+
+// CloudeventsEventSource returns an attribute KeyValue conforming to the
+// "cloudevents.event_source" semantic conventions. It represents the
+// [source](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1)
+// identifies the context in which an event happened.
+func CloudeventsEventSource(val string) attribute.KeyValue {
+ return CloudeventsEventSourceKey.String(val)
+}
+
+// CloudeventsEventSpecVersion returns an attribute KeyValue conforming to
+// the "cloudevents.event_spec_version" semantic conventions. It represents the
+// [version of the CloudEvents
+// specification](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion)
+// which the event uses.
+func CloudeventsEventSpecVersion(val string) attribute.KeyValue {
+ return CloudeventsEventSpecVersionKey.String(val)
+}
+
+// CloudeventsEventType returns an attribute KeyValue conforming to the
+// "cloudevents.event_type" semantic conventions. It represents the
+// [event_type](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type)
+// contains a value describing the type of event related to the originating
+// occurrence.
+func CloudeventsEventType(val string) attribute.KeyValue {
+ return CloudeventsEventTypeKey.String(val)
+}
+
+// CloudeventsEventSubject returns an attribute KeyValue conforming to the
+// "cloudevents.event_subject" semantic conventions. It represents the
+// [subject](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject)
+// of the event in the context of the event producer (identified by source).
+func CloudeventsEventSubject(val string) attribute.KeyValue {
+ return CloudeventsEventSubjectKey.String(val)
+}
+
+// Semantic conventions for the OpenTracing Shim
+const (
+ // OpentracingRefTypeKey is the attribute Key conforming to the
+ // "opentracing.ref_type" semantic conventions. It represents the
+ // parent-child Reference type
+ //
+ // Type: Enum
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Note: The causal relationship between a child Span and a parent Span.
+ OpentracingRefTypeKey = attribute.Key("opentracing.ref_type")
+)
+
+var (
+ // The parent Span depends on the child Span in some capacity
+ OpentracingRefTypeChildOf = OpentracingRefTypeKey.String("child_of")
+ // The parent Span does not depend in any way on the result of the child Span
+ OpentracingRefTypeFollowsFrom = OpentracingRefTypeKey.String("follows_from")
+)
+
+// The attributes used to perform database client calls.
+const (
+ // DBSystemKey is the attribute Key conforming to the "db.system" semantic
+ // conventions. It represents an identifier for the database management
+ // system (DBMS) product being used. See below for a list of well-known
+ // identifiers.
+ //
+ // Type: Enum
+ // RequirementLevel: Required
+ // Stability: stable
+ DBSystemKey = attribute.Key("db.system")
+
+ // DBConnectionStringKey is the attribute Key conforming to the
+ // "db.connection_string" semantic conventions. It represents the
+ // connection string used to connect to the database. It is recommended to
+ // remove embedded credentials.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Server=(localdb)\\v11.0;Integrated Security=true;'
+ DBConnectionStringKey = attribute.Key("db.connection_string")
+
+ // DBUserKey is the attribute Key conforming to the "db.user" semantic
+ // conventions. It represents the username for accessing the database.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'readonly_user', 'reporting_user'
+ DBUserKey = attribute.Key("db.user")
+
+ // DBJDBCDriverClassnameKey is the attribute Key conforming to the
+ // "db.jdbc.driver_classname" semantic conventions. It represents the
+ // fully-qualified class name of the [Java Database Connectivity
+ // (JDBC)](https://docs.oracle.com/javase/8/docs/technotes/guides/jdbc/)
+ // driver used to connect.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'org.postgresql.Driver',
+ // 'com.microsoft.sqlserver.jdbc.SQLServerDriver'
+ DBJDBCDriverClassnameKey = attribute.Key("db.jdbc.driver_classname")
+
+ // DBNameKey is the attribute Key conforming to the "db.name" semantic
+ // conventions. It represents the this attribute is used to report the name
+ // of the database being accessed. For commands that switch the database,
+ // this should be set to the target database (even if the command fails).
+ //
+ // Type: string
+ // RequirementLevel: ConditionallyRequired (If applicable.)
+ // Stability: stable
+ // Examples: 'customers', 'main'
+ // Note: In some SQL databases, the database name to be used is called
+ // "schema name". In case there are multiple layers that could be
+ // considered for database name (e.g. Oracle instance name and schema
+ // name), the database name to be used is the more specific layer (e.g.
+ // Oracle schema name).
+ DBNameKey = attribute.Key("db.name")
+
+ // DBStatementKey is the attribute Key conforming to the "db.statement"
+ // semantic conventions. It represents the database statement being
+ // executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended (Should be collected by default only if
+ // there is sanitization that excludes sensitive information.)
+ // Stability: stable
+ // Examples: 'SELECT * FROM wuser_table', 'SET mykey "WuValue"'
+ DBStatementKey = attribute.Key("db.statement")
+
+ // DBOperationKey is the attribute Key conforming to the "db.operation"
+ // semantic conventions. It represents the name of the operation being
+ // executed, e.g. the [MongoDB command
+ // name](https://docs.mongodb.com/manual/reference/command/#database-operations)
+ // such as `findAndModify`, or the SQL keyword.
+ //
+ // Type: string
+ // RequirementLevel: ConditionallyRequired (If `db.statement` is not
+ // applicable.)
+ // Stability: stable
+ // Examples: 'findAndModify', 'HMSET', 'SELECT'
+ // Note: When setting this to an SQL keyword, it is not recommended to
+ // attempt any client-side parsing of `db.statement` just to get this
+ // property, but it should be set if the operation name is provided by the
+ // library being instrumented. If the SQL statement has an ambiguous
+ // operation, or performs more than one operation, this value may be
+ // omitted.
+ DBOperationKey = attribute.Key("db.operation")
+)
+
+var (
+ // Some other SQL database. Fallback only. See notes
+ DBSystemOtherSQL = DBSystemKey.String("other_sql")
+ // Microsoft SQL Server
+ DBSystemMSSQL = DBSystemKey.String("mssql")
+ // Microsoft SQL Server Compact
+ DBSystemMssqlcompact = DBSystemKey.String("mssqlcompact")
+ // MySQL
+ DBSystemMySQL = DBSystemKey.String("mysql")
+ // Oracle Database
+ DBSystemOracle = DBSystemKey.String("oracle")
+ // IBM DB2
+ DBSystemDB2 = DBSystemKey.String("db2")
+ // PostgreSQL
+ DBSystemPostgreSQL = DBSystemKey.String("postgresql")
+ // Amazon Redshift
+ DBSystemRedshift = DBSystemKey.String("redshift")
+ // Apache Hive
+ DBSystemHive = DBSystemKey.String("hive")
+ // Cloudscape
+ DBSystemCloudscape = DBSystemKey.String("cloudscape")
+ // HyperSQL DataBase
+ DBSystemHSQLDB = DBSystemKey.String("hsqldb")
+ // Progress Database
+ DBSystemProgress = DBSystemKey.String("progress")
+ // SAP MaxDB
+ DBSystemMaxDB = DBSystemKey.String("maxdb")
+ // SAP HANA
+ DBSystemHanaDB = DBSystemKey.String("hanadb")
+ // Ingres
+ DBSystemIngres = DBSystemKey.String("ingres")
+ // FirstSQL
+ DBSystemFirstSQL = DBSystemKey.String("firstsql")
+ // EnterpriseDB
+ DBSystemEDB = DBSystemKey.String("edb")
+ // InterSystems Caché
+ DBSystemCache = DBSystemKey.String("cache")
+ // Adabas (Adaptable Database System)
+ DBSystemAdabas = DBSystemKey.String("adabas")
+ // Firebird
+ DBSystemFirebird = DBSystemKey.String("firebird")
+ // Apache Derby
+ DBSystemDerby = DBSystemKey.String("derby")
+ // FileMaker
+ DBSystemFilemaker = DBSystemKey.String("filemaker")
+ // Informix
+ DBSystemInformix = DBSystemKey.String("informix")
+ // InstantDB
+ DBSystemInstantDB = DBSystemKey.String("instantdb")
+ // InterBase
+ DBSystemInterbase = DBSystemKey.String("interbase")
+ // MariaDB
+ DBSystemMariaDB = DBSystemKey.String("mariadb")
+ // Netezza
+ DBSystemNetezza = DBSystemKey.String("netezza")
+ // Pervasive PSQL
+ DBSystemPervasive = DBSystemKey.String("pervasive")
+ // PointBase
+ DBSystemPointbase = DBSystemKey.String("pointbase")
+ // SQLite
+ DBSystemSqlite = DBSystemKey.String("sqlite")
+ // Sybase
+ DBSystemSybase = DBSystemKey.String("sybase")
+ // Teradata
+ DBSystemTeradata = DBSystemKey.String("teradata")
+ // Vertica
+ DBSystemVertica = DBSystemKey.String("vertica")
+ // H2
+ DBSystemH2 = DBSystemKey.String("h2")
+ // ColdFusion IMQ
+ DBSystemColdfusion = DBSystemKey.String("coldfusion")
+ // Apache Cassandra
+ DBSystemCassandra = DBSystemKey.String("cassandra")
+ // Apache HBase
+ DBSystemHBase = DBSystemKey.String("hbase")
+ // MongoDB
+ DBSystemMongoDB = DBSystemKey.String("mongodb")
+ // Redis
+ DBSystemRedis = DBSystemKey.String("redis")
+ // Couchbase
+ DBSystemCouchbase = DBSystemKey.String("couchbase")
+ // CouchDB
+ DBSystemCouchDB = DBSystemKey.String("couchdb")
+ // Microsoft Azure Cosmos DB
+ DBSystemCosmosDB = DBSystemKey.String("cosmosdb")
+ // Amazon DynamoDB
+ DBSystemDynamoDB = DBSystemKey.String("dynamodb")
+ // Neo4j
+ DBSystemNeo4j = DBSystemKey.String("neo4j")
+ // Apache Geode
+ DBSystemGeode = DBSystemKey.String("geode")
+ // Elasticsearch
+ DBSystemElasticsearch = DBSystemKey.String("elasticsearch")
+ // Memcached
+ DBSystemMemcached = DBSystemKey.String("memcached")
+ // CockroachDB
+ DBSystemCockroachdb = DBSystemKey.String("cockroachdb")
+ // OpenSearch
+ DBSystemOpensearch = DBSystemKey.String("opensearch")
+ // ClickHouse
+ DBSystemClickhouse = DBSystemKey.String("clickhouse")
+ // Cloud Spanner
+ DBSystemSpanner = DBSystemKey.String("spanner")
+ // Trino
+ DBSystemTrino = DBSystemKey.String("trino")
+)
+
+// DBConnectionString returns an attribute KeyValue conforming to the
+// "db.connection_string" semantic conventions. It represents the connection
+// string used to connect to the database. It is recommended to remove embedded
+// credentials.
+func DBConnectionString(val string) attribute.KeyValue {
+ return DBConnectionStringKey.String(val)
+}
+
+// DBUser returns an attribute KeyValue conforming to the "db.user" semantic
+// conventions. It represents the username for accessing the database.
+func DBUser(val string) attribute.KeyValue {
+ return DBUserKey.String(val)
+}
+
+// DBJDBCDriverClassname returns an attribute KeyValue conforming to the
+// "db.jdbc.driver_classname" semantic conventions. It represents the
+// fully-qualified class name of the [Java Database Connectivity
+// (JDBC)](https://docs.oracle.com/javase/8/docs/technotes/guides/jdbc/) driver
+// used to connect.
+func DBJDBCDriverClassname(val string) attribute.KeyValue {
+ return DBJDBCDriverClassnameKey.String(val)
+}
+
+// DBName returns an attribute KeyValue conforming to the "db.name" semantic
+// conventions. It represents the this attribute is used to report the name of
+// the database being accessed. For commands that switch the database, this
+// should be set to the target database (even if the command fails).
+func DBName(val string) attribute.KeyValue {
+ return DBNameKey.String(val)
+}
+
+// DBStatement returns an attribute KeyValue conforming to the
+// "db.statement" semantic conventions. It represents the database statement
+// being executed.
+func DBStatement(val string) attribute.KeyValue {
+ return DBStatementKey.String(val)
+}
+
+// DBOperation returns an attribute KeyValue conforming to the
+// "db.operation" semantic conventions. It represents the name of the operation
+// being executed, e.g. the [MongoDB command
+// name](https://docs.mongodb.com/manual/reference/command/#database-operations)
+// such as `findAndModify`, or the SQL keyword.
+func DBOperation(val string) attribute.KeyValue {
+ return DBOperationKey.String(val)
+}
+
+// Connection-level attributes for Microsoft SQL Server
+const (
+ // DBMSSQLInstanceNameKey is the attribute Key conforming to the
+ // "db.mssql.instance_name" semantic conventions. It represents the
+ // Microsoft SQL Server [instance
+ // name](https://docs.microsoft.com/en-us/sql/connect/jdbc/building-the-connection-url?view=sql-server-ver15)
+ // connecting to. This name is used to determine the port of a named
+ // instance.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'MSSQLSERVER'
+ // Note: If setting a `db.mssql.instance_name`, `server.port` is no longer
+ // required (but still recommended if non-standard).
+ DBMSSQLInstanceNameKey = attribute.Key("db.mssql.instance_name")
+)
+
+// DBMSSQLInstanceName returns an attribute KeyValue conforming to the
+// "db.mssql.instance_name" semantic conventions. It represents the Microsoft
+// SQL Server [instance
+// name](https://docs.microsoft.com/en-us/sql/connect/jdbc/building-the-connection-url?view=sql-server-ver15)
+// connecting to. This name is used to determine the port of a named instance.
+func DBMSSQLInstanceName(val string) attribute.KeyValue {
+ return DBMSSQLInstanceNameKey.String(val)
+}
+
+// Call-level attributes for Cassandra
+const (
+ // DBCassandraPageSizeKey is the attribute Key conforming to the
+ // "db.cassandra.page_size" semantic conventions. It represents the fetch
+ // size used for paging, i.e. how many rows will be returned at once.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 5000
+ DBCassandraPageSizeKey = attribute.Key("db.cassandra.page_size")
+
+ // DBCassandraConsistencyLevelKey is the attribute Key conforming to the
+ // "db.cassandra.consistency_level" semantic conventions. It represents the
+ // consistency level of the query. Based on consistency values from
+ // [CQL](https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html).
+ //
+ // Type: Enum
+ // RequirementLevel: Optional
+ // Stability: stable
+ DBCassandraConsistencyLevelKey = attribute.Key("db.cassandra.consistency_level")
+
+ // DBCassandraTableKey is the attribute Key conforming to the
+ // "db.cassandra.table" semantic conventions. It represents the name of the
+ // primary table that the operation is acting upon, including the keyspace
+ // name (if applicable).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: stable
+ // Examples: 'mytable'
+ // Note: This mirrors the db.sql.table attribute but references cassandra
+ // rather than sql. It is not recommended to attempt any client-side
+ // parsing of `db.statement` just to get this property, but it should be
+ // set if it is provided by the library being instrumented. If the
+ // operation is acting upon an anonymous table, or more than one table,
+ // this value MUST NOT be set.
+ DBCassandraTableKey = attribute.Key("db.cassandra.table")
+
+ // DBCassandraIdempotenceKey is the attribute Key conforming to the
+ // "db.cassandra.idempotence" semantic conventions. It represents the
+ // whether or not the query is idempotent.
+ //
+ // Type: boolean
+ // RequirementLevel: Optional
+ // Stability: stable
+ DBCassandraIdempotenceKey = attribute.Key("db.cassandra.idempotence")
+
+ // DBCassandraSpeculativeExecutionCountKey is the attribute Key conforming
+ // to the "db.cassandra.speculative_execution_count" semantic conventions.
+ // It represents the number of times a query was speculatively executed.
+ // Not set or `0` if the query was not executed speculatively.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 0, 2
+ DBCassandraSpeculativeExecutionCountKey = attribute.Key("db.cassandra.speculative_execution_count")
+
+ // DBCassandraCoordinatorIDKey is the attribute Key conforming to the
+ // "db.cassandra.coordinator.id" semantic conventions. It represents the ID
+ // of the coordinating node for a query.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'be13faa2-8574-4d71-926d-27f16cf8a7af'
+ DBCassandraCoordinatorIDKey = attribute.Key("db.cassandra.coordinator.id")
+
+ // DBCassandraCoordinatorDCKey is the attribute Key conforming to the
+ // "db.cassandra.coordinator.dc" semantic conventions. It represents the
+ // data center of the coordinating node for a query.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'us-west-2'
+ DBCassandraCoordinatorDCKey = attribute.Key("db.cassandra.coordinator.dc")
+)
+
+var (
+ // all
+ DBCassandraConsistencyLevelAll = DBCassandraConsistencyLevelKey.String("all")
+ // each_quorum
+ DBCassandraConsistencyLevelEachQuorum = DBCassandraConsistencyLevelKey.String("each_quorum")
+ // quorum
+ DBCassandraConsistencyLevelQuorum = DBCassandraConsistencyLevelKey.String("quorum")
+ // local_quorum
+ DBCassandraConsistencyLevelLocalQuorum = DBCassandraConsistencyLevelKey.String("local_quorum")
+ // one
+ DBCassandraConsistencyLevelOne = DBCassandraConsistencyLevelKey.String("one")
+ // two
+ DBCassandraConsistencyLevelTwo = DBCassandraConsistencyLevelKey.String("two")
+ // three
+ DBCassandraConsistencyLevelThree = DBCassandraConsistencyLevelKey.String("three")
+ // local_one
+ DBCassandraConsistencyLevelLocalOne = DBCassandraConsistencyLevelKey.String("local_one")
+ // any
+ DBCassandraConsistencyLevelAny = DBCassandraConsistencyLevelKey.String("any")
+ // serial
+ DBCassandraConsistencyLevelSerial = DBCassandraConsistencyLevelKey.String("serial")
+ // local_serial
+ DBCassandraConsistencyLevelLocalSerial = DBCassandraConsistencyLevelKey.String("local_serial")
+)
+
+// DBCassandraPageSize returns an attribute KeyValue conforming to the
+// "db.cassandra.page_size" semantic conventions. It represents the fetch size
+// used for paging, i.e. how many rows will be returned at once.
+func DBCassandraPageSize(val int) attribute.KeyValue {
+ return DBCassandraPageSizeKey.Int(val)
+}
+
+// DBCassandraTable returns an attribute KeyValue conforming to the
+// "db.cassandra.table" semantic conventions. It represents the name of the
+// primary table that the operation is acting upon, including the keyspace name
+// (if applicable).
+func DBCassandraTable(val string) attribute.KeyValue {
+ return DBCassandraTableKey.String(val)
+}
+
+// DBCassandraIdempotence returns an attribute KeyValue conforming to the
+// "db.cassandra.idempotence" semantic conventions. It represents the whether
+// or not the query is idempotent.
+func DBCassandraIdempotence(val bool) attribute.KeyValue {
+ return DBCassandraIdempotenceKey.Bool(val)
+}
+
+// DBCassandraSpeculativeExecutionCount returns an attribute KeyValue
+// conforming to the "db.cassandra.speculative_execution_count" semantic
+// conventions. It represents the number of times a query was speculatively
+// executed. Not set or `0` if the query was not executed speculatively.
+func DBCassandraSpeculativeExecutionCount(val int) attribute.KeyValue {
+ return DBCassandraSpeculativeExecutionCountKey.Int(val)
+}
+
+// DBCassandraCoordinatorID returns an attribute KeyValue conforming to the
+// "db.cassandra.coordinator.id" semantic conventions. It represents the ID of
+// the coordinating node for a query.
+func DBCassandraCoordinatorID(val string) attribute.KeyValue {
+ return DBCassandraCoordinatorIDKey.String(val)
+}
+
+// DBCassandraCoordinatorDC returns an attribute KeyValue conforming to the
+// "db.cassandra.coordinator.dc" semantic conventions. It represents the data
+// center of the coordinating node for a query.
+func DBCassandraCoordinatorDC(val string) attribute.KeyValue {
+ return DBCassandraCoordinatorDCKey.String(val)
+}
+
+// Call-level attributes for Redis
+const (
+ // DBRedisDBIndexKey is the attribute Key conforming to the
+ // "db.redis.database_index" semantic conventions. It represents the index
+ // of the database being accessed as used in the [`SELECT`
+ // command](https://redis.io/commands/select), provided as an integer. To
+ // be used instead of the generic `db.name` attribute.
+ //
+ // Type: int
+ // RequirementLevel: ConditionallyRequired (If other than the default
+ // database (`0`).)
+ // Stability: stable
+ // Examples: 0, 1, 15
+ DBRedisDBIndexKey = attribute.Key("db.redis.database_index")
+)
+
+// DBRedisDBIndex returns an attribute KeyValue conforming to the
+// "db.redis.database_index" semantic conventions. It represents the index of
+// the database being accessed as used in the [`SELECT`
+// command](https://redis.io/commands/select), provided as an integer. To be
+// used instead of the generic `db.name` attribute.
+func DBRedisDBIndex(val int) attribute.KeyValue {
+ return DBRedisDBIndexKey.Int(val)
+}
+
+// Call-level attributes for MongoDB
+const (
+ // DBMongoDBCollectionKey is the attribute Key conforming to the
+ // "db.mongodb.collection" semantic conventions. It represents the
+ // collection being accessed within the database stated in `db.name`.
+ //
+ // Type: string
+ // RequirementLevel: Required
+ // Stability: stable
+ // Examples: 'customers', 'products'
+ DBMongoDBCollectionKey = attribute.Key("db.mongodb.collection")
+)
+
+// DBMongoDBCollection returns an attribute KeyValue conforming to the
+// "db.mongodb.collection" semantic conventions. It represents the collection
+// being accessed within the database stated in `db.name`.
+func DBMongoDBCollection(val string) attribute.KeyValue {
+ return DBMongoDBCollectionKey.String(val)
+}
+
+// Call-level attributes for SQL databases
+const (
+ // DBSQLTableKey is the attribute Key conforming to the "db.sql.table"
+ // semantic conventions. It represents the name of the primary table that
+ // the operation is acting upon, including the database name (if
+ // applicable).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: stable
+ // Examples: 'public.users', 'customers'
+ // Note: It is not recommended to attempt any client-side parsing of
+ // `db.statement` just to get this property, but it should be set if it is
+ // provided by the library being instrumented. If the operation is acting
+ // upon an anonymous table, or more than one table, this value MUST NOT be
+ // set.
+ DBSQLTableKey = attribute.Key("db.sql.table")
+)
+
+// DBSQLTable returns an attribute KeyValue conforming to the "db.sql.table"
+// semantic conventions. It represents the name of the primary table that the
+// operation is acting upon, including the database name (if applicable).
+func DBSQLTable(val string) attribute.KeyValue {
+ return DBSQLTableKey.String(val)
+}
+
+// Call-level attributes for Cosmos DB.
+const (
+ // DBCosmosDBClientIDKey is the attribute Key conforming to the
+ // "db.cosmosdb.client_id" semantic conventions. It represents the unique
+ // Cosmos client instance id.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '3ba4827d-4422-483f-b59f-85b74211c11d'
+ DBCosmosDBClientIDKey = attribute.Key("db.cosmosdb.client_id")
+
+ // DBCosmosDBOperationTypeKey is the attribute Key conforming to the
+ // "db.cosmosdb.operation_type" semantic conventions. It represents the
+ // cosmosDB Operation Type.
+ //
+ // Type: Enum
+ // RequirementLevel: ConditionallyRequired (when performing one of the
+ // operations in this list)
+ // Stability: stable
+ DBCosmosDBOperationTypeKey = attribute.Key("db.cosmosdb.operation_type")
+
+ // DBCosmosDBConnectionModeKey is the attribute Key conforming to the
+ // "db.cosmosdb.connection_mode" semantic conventions. It represents the
+ // cosmos client connection mode.
+ //
+ // Type: Enum
+ // RequirementLevel: ConditionallyRequired (if not `direct` (or pick gw as
+ // default))
+ // Stability: stable
+ DBCosmosDBConnectionModeKey = attribute.Key("db.cosmosdb.connection_mode")
+
+ // DBCosmosDBContainerKey is the attribute Key conforming to the
+ // "db.cosmosdb.container" semantic conventions. It represents the cosmos
+ // DB container name.
+ //
+ // Type: string
+ // RequirementLevel: ConditionallyRequired (if available)
+ // Stability: stable
+ // Examples: 'anystring'
+ DBCosmosDBContainerKey = attribute.Key("db.cosmosdb.container")
+
+ // DBCosmosDBRequestContentLengthKey is the attribute Key conforming to the
+ // "db.cosmosdb.request_content_length" semantic conventions. It represents
+ // the request payload size in bytes
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ DBCosmosDBRequestContentLengthKey = attribute.Key("db.cosmosdb.request_content_length")
+
+ // DBCosmosDBStatusCodeKey is the attribute Key conforming to the
+ // "db.cosmosdb.status_code" semantic conventions. It represents the cosmos
+ // DB status code.
+ //
+ // Type: int
+ // RequirementLevel: ConditionallyRequired (if response was received)
+ // Stability: stable
+ // Examples: 200, 201
+ DBCosmosDBStatusCodeKey = attribute.Key("db.cosmosdb.status_code")
+
+ // DBCosmosDBSubStatusCodeKey is the attribute Key conforming to the
+ // "db.cosmosdb.sub_status_code" semantic conventions. It represents the
+ // cosmos DB sub status code.
+ //
+ // Type: int
+ // RequirementLevel: ConditionallyRequired (when response was received and
+ // contained sub-code.)
+ // Stability: stable
+ // Examples: 1000, 1002
+ DBCosmosDBSubStatusCodeKey = attribute.Key("db.cosmosdb.sub_status_code")
+
+ // DBCosmosDBRequestChargeKey is the attribute Key conforming to the
+ // "db.cosmosdb.request_charge" semantic conventions. It represents the rU
+ // consumed for that operation
+ //
+ // Type: double
+ // RequirementLevel: ConditionallyRequired (when available)
+ // Stability: stable
+ // Examples: 46.18, 1.0
+ DBCosmosDBRequestChargeKey = attribute.Key("db.cosmosdb.request_charge")
+)
+
+var (
+ // invalid
+ DBCosmosDBOperationTypeInvalid = DBCosmosDBOperationTypeKey.String("Invalid")
+ // create
+ DBCosmosDBOperationTypeCreate = DBCosmosDBOperationTypeKey.String("Create")
+ // patch
+ DBCosmosDBOperationTypePatch = DBCosmosDBOperationTypeKey.String("Patch")
+ // read
+ DBCosmosDBOperationTypeRead = DBCosmosDBOperationTypeKey.String("Read")
+ // read_feed
+ DBCosmosDBOperationTypeReadFeed = DBCosmosDBOperationTypeKey.String("ReadFeed")
+ // delete
+ DBCosmosDBOperationTypeDelete = DBCosmosDBOperationTypeKey.String("Delete")
+ // replace
+ DBCosmosDBOperationTypeReplace = DBCosmosDBOperationTypeKey.String("Replace")
+ // execute
+ DBCosmosDBOperationTypeExecute = DBCosmosDBOperationTypeKey.String("Execute")
+ // query
+ DBCosmosDBOperationTypeQuery = DBCosmosDBOperationTypeKey.String("Query")
+ // head
+ DBCosmosDBOperationTypeHead = DBCosmosDBOperationTypeKey.String("Head")
+ // head_feed
+ DBCosmosDBOperationTypeHeadFeed = DBCosmosDBOperationTypeKey.String("HeadFeed")
+ // upsert
+ DBCosmosDBOperationTypeUpsert = DBCosmosDBOperationTypeKey.String("Upsert")
+ // batch
+ DBCosmosDBOperationTypeBatch = DBCosmosDBOperationTypeKey.String("Batch")
+ // query_plan
+ DBCosmosDBOperationTypeQueryPlan = DBCosmosDBOperationTypeKey.String("QueryPlan")
+ // execute_javascript
+ DBCosmosDBOperationTypeExecuteJavascript = DBCosmosDBOperationTypeKey.String("ExecuteJavaScript")
+)
+
+var (
+ // Gateway (HTTP) connections mode
+ DBCosmosDBConnectionModeGateway = DBCosmosDBConnectionModeKey.String("gateway")
+ // Direct connection
+ DBCosmosDBConnectionModeDirect = DBCosmosDBConnectionModeKey.String("direct")
+)
+
+// DBCosmosDBClientID returns an attribute KeyValue conforming to the
+// "db.cosmosdb.client_id" semantic conventions. It represents the unique
+// Cosmos client instance id.
+func DBCosmosDBClientID(val string) attribute.KeyValue {
+ return DBCosmosDBClientIDKey.String(val)
+}
+
+// DBCosmosDBContainer returns an attribute KeyValue conforming to the
+// "db.cosmosdb.container" semantic conventions. It represents the cosmos DB
+// container name.
+func DBCosmosDBContainer(val string) attribute.KeyValue {
+ return DBCosmosDBContainerKey.String(val)
+}
+
+// DBCosmosDBRequestContentLength returns an attribute KeyValue conforming
+// to the "db.cosmosdb.request_content_length" semantic conventions. It
+// represents the request payload size in bytes
+func DBCosmosDBRequestContentLength(val int) attribute.KeyValue {
+ return DBCosmosDBRequestContentLengthKey.Int(val)
+}
+
+// DBCosmosDBStatusCode returns an attribute KeyValue conforming to the
+// "db.cosmosdb.status_code" semantic conventions. It represents the cosmos DB
+// status code.
+func DBCosmosDBStatusCode(val int) attribute.KeyValue {
+ return DBCosmosDBStatusCodeKey.Int(val)
+}
+
+// DBCosmosDBSubStatusCode returns an attribute KeyValue conforming to the
+// "db.cosmosdb.sub_status_code" semantic conventions. It represents the cosmos
+// DB sub status code.
+func DBCosmosDBSubStatusCode(val int) attribute.KeyValue {
+ return DBCosmosDBSubStatusCodeKey.Int(val)
+}
+
+// DBCosmosDBRequestCharge returns an attribute KeyValue conforming to the
+// "db.cosmosdb.request_charge" semantic conventions. It represents the rU
+// consumed for that operation
+func DBCosmosDBRequestCharge(val float64) attribute.KeyValue {
+ return DBCosmosDBRequestChargeKey.Float64(val)
+}
+
+// Span attributes used by non-OTLP exporters to represent OpenTelemetry Span's
+// concepts.
+const (
+ // OTelStatusCodeKey is the attribute Key conforming to the
+ // "otel.status_code" semantic conventions. It represents the name of the
+ // code, either "OK" or "ERROR". MUST NOT be set if the status code is
+ // UNSET.
+ //
+ // Type: Enum
+ // RequirementLevel: Optional
+ // Stability: stable
+ OTelStatusCodeKey = attribute.Key("otel.status_code")
+
+ // OTelStatusDescriptionKey is the attribute Key conforming to the
+ // "otel.status_description" semantic conventions. It represents the
+ // description of the Status if it has a value, otherwise not set.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'resource not found'
+ OTelStatusDescriptionKey = attribute.Key("otel.status_description")
+)
+
+var (
+ // The operation has been validated by an Application developer or Operator to have completed successfully
+ OTelStatusCodeOk = OTelStatusCodeKey.String("OK")
+ // The operation contains an error
+ OTelStatusCodeError = OTelStatusCodeKey.String("ERROR")
+)
+
+// OTelStatusDescription returns an attribute KeyValue conforming to the
+// "otel.status_description" semantic conventions. It represents the
+// description of the Status if it has a value, otherwise not set.
+func OTelStatusDescription(val string) attribute.KeyValue {
+ return OTelStatusDescriptionKey.String(val)
+}
+
+// This semantic convention describes an instance of a function that runs
+// without provisioning or managing of servers (also known as serverless
+// functions or Function as a Service (FaaS)) with spans.
+const (
+ // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger"
+ // semantic conventions. It represents the type of the trigger which caused
+ // this function invocation.
+ //
+ // Type: Enum
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Note: For the server/consumer span on the incoming side,
+ // `faas.trigger` MUST be set.
+ //
+ // Clients invoking FaaS instances usually cannot set `faas.trigger`,
+ // since they would typically need to look in the payload to determine
+ // the event type. If clients set it, it should be the same as the
+ // trigger that corresponding incoming would have (i.e., this has
+ // nothing to do with the underlying transport used to make the API
+ // call to invoke the lambda, which is often HTTP).
+ FaaSTriggerKey = attribute.Key("faas.trigger")
+
+ // FaaSInvocationIDKey is the attribute Key conforming to the
+ // "faas.invocation_id" semantic conventions. It represents the invocation
+ // ID of the current function invocation.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'af9d5aa4-a685-4c5f-a22b-444f80b3cc28'
+ FaaSInvocationIDKey = attribute.Key("faas.invocation_id")
+)
+
+var (
+ // A response to some data source operation such as a database or filesystem read/write
+ FaaSTriggerDatasource = FaaSTriggerKey.String("datasource")
+ // To provide an answer to an inbound HTTP request
+ FaaSTriggerHTTP = FaaSTriggerKey.String("http")
+ // A function is set to be executed when messages are sent to a messaging system
+ FaaSTriggerPubsub = FaaSTriggerKey.String("pubsub")
+ // A function is scheduled to be executed regularly
+ FaaSTriggerTimer = FaaSTriggerKey.String("timer")
+ // If none of the others apply
+ FaaSTriggerOther = FaaSTriggerKey.String("other")
+)
+
+// FaaSInvocationID returns an attribute KeyValue conforming to the
+// "faas.invocation_id" semantic conventions. It represents the invocation ID
+// of the current function invocation.
+func FaaSInvocationID(val string) attribute.KeyValue {
+ return FaaSInvocationIDKey.String(val)
+}
+
+// Semantic Convention for FaaS triggered as a response to some data source
+// operation such as a database or filesystem read/write.
+const (
+ // FaaSDocumentCollectionKey is the attribute Key conforming to the
+ // "faas.document.collection" semantic conventions. It represents the name
+ // of the source on which the triggering operation was performed. For
+ // example, in Cloud Storage or S3 corresponds to the bucket name, and in
+ // Cosmos DB to the database name.
+ //
+ // Type: string
+ // RequirementLevel: Required
+ // Stability: stable
+ // Examples: 'myBucketName', 'myDBName'
+ FaaSDocumentCollectionKey = attribute.Key("faas.document.collection")
+
+ // FaaSDocumentOperationKey is the attribute Key conforming to the
+ // "faas.document.operation" semantic conventions. It represents the
+ // describes the type of the operation that was performed on the data.
+ //
+ // Type: Enum
+ // RequirementLevel: Required
+ // Stability: stable
+ FaaSDocumentOperationKey = attribute.Key("faas.document.operation")
+
+ // FaaSDocumentTimeKey is the attribute Key conforming to the
+ // "faas.document.time" semantic conventions. It represents a string
+ // containing the time when the data was accessed in the [ISO
+ // 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
+ // expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '2020-01-23T13:47:06Z'
+ FaaSDocumentTimeKey = attribute.Key("faas.document.time")
+
+ // FaaSDocumentNameKey is the attribute Key conforming to the
+ // "faas.document.name" semantic conventions. It represents the document
+ // name/table subjected to the operation. For example, in Cloud Storage or
+ // S3 is the name of the file, and in Cosmos DB the table name.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'myFile.txt', 'myTableName'
+ FaaSDocumentNameKey = attribute.Key("faas.document.name")
+)
+
+var (
+ // When a new object is created
+ FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert")
+ // When an object is modified
+ FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit")
+ // When an object is deleted
+ FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete")
+)
+
+// FaaSDocumentCollection returns an attribute KeyValue conforming to the
+// "faas.document.collection" semantic conventions. It represents the name of
+// the source on which the triggering operation was performed. For example, in
+// Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the
+// database name.
+func FaaSDocumentCollection(val string) attribute.KeyValue {
+ return FaaSDocumentCollectionKey.String(val)
+}
+
+// FaaSDocumentTime returns an attribute KeyValue conforming to the
+// "faas.document.time" semantic conventions. It represents a string containing
+// the time when the data was accessed in the [ISO
+// 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
+// expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
+func FaaSDocumentTime(val string) attribute.KeyValue {
+ return FaaSDocumentTimeKey.String(val)
+}
+
+// FaaSDocumentName returns an attribute KeyValue conforming to the
+// "faas.document.name" semantic conventions. It represents the document
+// name/table subjected to the operation. For example, in Cloud Storage or S3
+// is the name of the file, and in Cosmos DB the table name.
+func FaaSDocumentName(val string) attribute.KeyValue {
+ return FaaSDocumentNameKey.String(val)
+}
+
+// Semantic Convention for FaaS scheduled to be executed regularly.
+const (
+ // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic
+ // conventions. It represents a string containing the function invocation
+ // time in the [ISO
+ // 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
+ // expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '2020-01-23T13:47:06Z'
+ FaaSTimeKey = attribute.Key("faas.time")
+
+ // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic
+ // conventions. It represents a string containing the schedule period as
+ // [Cron
+ // Expression](https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '0/5 * * * ? *'
+ FaaSCronKey = attribute.Key("faas.cron")
+)
+
+// FaaSTime returns an attribute KeyValue conforming to the "faas.time"
+// semantic conventions. It represents a string containing the function
+// invocation time in the [ISO
+// 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
+// expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
+func FaaSTime(val string) attribute.KeyValue {
+ return FaaSTimeKey.String(val)
+}
+
+// FaaSCron returns an attribute KeyValue conforming to the "faas.cron"
+// semantic conventions. It represents a string containing the schedule period
+// as [Cron
+// Expression](https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm).
+func FaaSCron(val string) attribute.KeyValue {
+ return FaaSCronKey.String(val)
+}
+
+// Contains additional attributes for incoming FaaS spans.
+const (
+ // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart"
+ // semantic conventions. It represents a boolean that is true if the
+ // serverless function is executed for the first time (aka cold-start).
+ //
+ // Type: boolean
+ // RequirementLevel: Optional
+ // Stability: stable
+ FaaSColdstartKey = attribute.Key("faas.coldstart")
+)
+
+// FaaSColdstart returns an attribute KeyValue conforming to the
+// "faas.coldstart" semantic conventions. It represents a boolean that is true
+// if the serverless function is executed for the first time (aka cold-start).
+func FaaSColdstart(val bool) attribute.KeyValue {
+ return FaaSColdstartKey.Bool(val)
+}
+
+// Contains additional attributes for outgoing FaaS spans.
+const (
+ // FaaSInvokedNameKey is the attribute Key conforming to the
+ // "faas.invoked_name" semantic conventions. It represents the name of the
+ // invoked function.
+ //
+ // Type: string
+ // RequirementLevel: Required
+ // Stability: stable
+ // Examples: 'my-function'
+ // Note: SHOULD be equal to the `faas.name` resource attribute of the
+ // invoked function.
+ FaaSInvokedNameKey = attribute.Key("faas.invoked_name")
+
+ // FaaSInvokedProviderKey is the attribute Key conforming to the
+ // "faas.invoked_provider" semantic conventions. It represents the cloud
+ // provider of the invoked function.
+ //
+ // Type: Enum
+ // RequirementLevel: Required
+ // Stability: stable
+ // Note: SHOULD be equal to the `cloud.provider` resource attribute of the
+ // invoked function.
+ FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider")
+
+ // FaaSInvokedRegionKey is the attribute Key conforming to the
+ // "faas.invoked_region" semantic conventions. It represents the cloud
+ // region of the invoked function.
+ //
+ // Type: string
+ // RequirementLevel: ConditionallyRequired (For some cloud providers, like
+ // AWS or GCP, the region in which a function is hosted is essential to
+ // uniquely identify the function and also part of its endpoint. Since it's
+ // part of the endpoint being called, the region is always known to
+ // clients. In these cases, `faas.invoked_region` MUST be set accordingly.
+ // If the region is unknown to the client or not required for identifying
+ // the invoked function, setting `faas.invoked_region` is optional.)
+ // Stability: stable
+ // Examples: 'eu-central-1'
+ // Note: SHOULD be equal to the `cloud.region` resource attribute of the
+ // invoked function.
+ FaaSInvokedRegionKey = attribute.Key("faas.invoked_region")
+)
+
+var (
+ // Alibaba Cloud
+ FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud")
+ // Amazon Web Services
+ FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws")
+ // Microsoft Azure
+ FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure")
+ // Google Cloud Platform
+ FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp")
+ // Tencent Cloud
+ FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud")
+)
+
+// FaaSInvokedName returns an attribute KeyValue conforming to the
+// "faas.invoked_name" semantic conventions. It represents the name of the
+// invoked function.
+func FaaSInvokedName(val string) attribute.KeyValue {
+ return FaaSInvokedNameKey.String(val)
+}
+
+// FaaSInvokedRegion returns an attribute KeyValue conforming to the
+// "faas.invoked_region" semantic conventions. It represents the cloud region
+// of the invoked function.
+func FaaSInvokedRegion(val string) attribute.KeyValue {
+ return FaaSInvokedRegionKey.String(val)
+}
+
+// Operations that access some remote service.
+const (
+ // PeerServiceKey is the attribute Key conforming to the "peer.service"
+ // semantic conventions. It represents the
+ // [`service.name`](/docs/resource/README.md#service) of the remote
+ // service. SHOULD be equal to the actual `service.name` resource attribute
+ // of the remote service if any.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'AuthTokenCache'
+ PeerServiceKey = attribute.Key("peer.service")
+)
+
+// PeerService returns an attribute KeyValue conforming to the
+// "peer.service" semantic conventions. It represents the
+// [`service.name`](/docs/resource/README.md#service) of the remote service.
+// SHOULD be equal to the actual `service.name` resource attribute of the
+// remote service if any.
+func PeerService(val string) attribute.KeyValue {
+ return PeerServiceKey.String(val)
+}
+
+// These attributes may be used for any operation with an authenticated and/or
+// authorized enduser.
+const (
+ // EnduserIDKey is the attribute Key conforming to the "enduser.id"
+ // semantic conventions. It represents the username or client_id extracted
+ // from the access token or
+ // [Authorization](https://tools.ietf.org/html/rfc7235#section-4.2) header
+ // in the inbound request from outside the system.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'username'
+ EnduserIDKey = attribute.Key("enduser.id")
+
+ // EnduserRoleKey is the attribute Key conforming to the "enduser.role"
+ // semantic conventions. It represents the actual/assumed role the client
+ // is making the request under extracted from token or application security
+ // context.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'admin'
+ EnduserRoleKey = attribute.Key("enduser.role")
+
+ // EnduserScopeKey is the attribute Key conforming to the "enduser.scope"
+ // semantic conventions. It represents the scopes or granted authorities
+ // the client currently possesses extracted from token or application
+ // security context. The value would come from the scope associated with an
+ // [OAuth 2.0 Access
+ // Token](https://tools.ietf.org/html/rfc6749#section-3.3) or an attribute
+ // value in a [SAML 2.0
+ // Assertion](http://docs.oasis-open.org/security/saml/Post2.0/sstc-saml-tech-overview-2.0.html).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'read:message, write:files'
+ EnduserScopeKey = attribute.Key("enduser.scope")
+)
+
+// EnduserID returns an attribute KeyValue conforming to the "enduser.id"
+// semantic conventions. It represents the username or client_id extracted from
+// the access token or
+// [Authorization](https://tools.ietf.org/html/rfc7235#section-4.2) header in
+// the inbound request from outside the system.
+func EnduserID(val string) attribute.KeyValue {
+ return EnduserIDKey.String(val)
+}
+
+// EnduserRole returns an attribute KeyValue conforming to the
+// "enduser.role" semantic conventions. It represents the actual/assumed role
+// the client is making the request under extracted from token or application
+// security context.
+func EnduserRole(val string) attribute.KeyValue {
+ return EnduserRoleKey.String(val)
+}
+
+// EnduserScope returns an attribute KeyValue conforming to the
+// "enduser.scope" semantic conventions. It represents the scopes or granted
+// authorities the client currently possesses extracted from token or
+// application security context. The value would come from the scope associated
+// with an [OAuth 2.0 Access
+// Token](https://tools.ietf.org/html/rfc6749#section-3.3) or an attribute
+// value in a [SAML 2.0
+// Assertion](http://docs.oasis-open.org/security/saml/Post2.0/sstc-saml-tech-overview-2.0.html).
+func EnduserScope(val string) attribute.KeyValue {
+ return EnduserScopeKey.String(val)
+}
+
+// These attributes may be used for any operation to store information about a
+// thread that started a span.
+const (
+ // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic
+ // conventions. It represents the current "managed" thread ID (as opposed
+ // to OS thread ID).
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 42
+ ThreadIDKey = attribute.Key("thread.id")
+
+ // ThreadNameKey is the attribute Key conforming to the "thread.name"
+ // semantic conventions. It represents the current thread name.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'main'
+ ThreadNameKey = attribute.Key("thread.name")
+)
+
+// ThreadID returns an attribute KeyValue conforming to the "thread.id"
+// semantic conventions. It represents the current "managed" thread ID (as
+// opposed to OS thread ID).
+func ThreadID(val int) attribute.KeyValue {
+ return ThreadIDKey.Int(val)
+}
+
+// ThreadName returns an attribute KeyValue conforming to the "thread.name"
+// semantic conventions. It represents the current thread name.
+func ThreadName(val string) attribute.KeyValue {
+ return ThreadNameKey.String(val)
+}
+
+// These attributes allow to report this unit of code and therefore to provide
+// more context about the span.
+const (
+ // CodeFunctionKey is the attribute Key conforming to the "code.function"
+ // semantic conventions. It represents the method or function name, or
+ // equivalent (usually rightmost part of the code unit's name).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'serveRequest'
+ CodeFunctionKey = attribute.Key("code.function")
+
+ // CodeNamespaceKey is the attribute Key conforming to the "code.namespace"
+ // semantic conventions. It represents the "namespace" within which
+ // `code.function` is defined. Usually the qualified class or module name,
+ // such that `code.namespace` + some separator + `code.function` form a
+ // unique identifier for the code unit.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'com.example.MyHTTPService'
+ CodeNamespaceKey = attribute.Key("code.namespace")
+
+ // CodeFilepathKey is the attribute Key conforming to the "code.filepath"
+ // semantic conventions. It represents the source code file name that
+ // identifies the code unit as uniquely as possible (preferably an absolute
+ // file path).
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '/usr/local/MyApplication/content_root/app/index.php'
+ CodeFilepathKey = attribute.Key("code.filepath")
+
+ // CodeLineNumberKey is the attribute Key conforming to the "code.lineno"
+ // semantic conventions. It represents the line number in `code.filepath`
+ // best representing the operation. It SHOULD point within the code unit
+ // named in `code.function`.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 42
+ CodeLineNumberKey = attribute.Key("code.lineno")
+
+ // CodeColumnKey is the attribute Key conforming to the "code.column"
+ // semantic conventions. It represents the column number in `code.filepath`
+ // best representing the operation. It SHOULD point within the code unit
+ // named in `code.function`.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 16
+ CodeColumnKey = attribute.Key("code.column")
+)
+
+// CodeFunction returns an attribute KeyValue conforming to the
+// "code.function" semantic conventions. It represents the method or function
+// name, or equivalent (usually rightmost part of the code unit's name).
+func CodeFunction(val string) attribute.KeyValue {
+ return CodeFunctionKey.String(val)
+}
+
+// CodeNamespace returns an attribute KeyValue conforming to the
+// "code.namespace" semantic conventions. It represents the "namespace" within
+// which `code.function` is defined. Usually the qualified class or module
+// name, such that `code.namespace` + some separator + `code.function` form a
+// unique identifier for the code unit.
+func CodeNamespace(val string) attribute.KeyValue {
+ return CodeNamespaceKey.String(val)
+}
+
+// CodeFilepath returns an attribute KeyValue conforming to the
+// "code.filepath" semantic conventions. It represents the source code file
+// name that identifies the code unit as uniquely as possible (preferably an
+// absolute file path).
+func CodeFilepath(val string) attribute.KeyValue {
+ return CodeFilepathKey.String(val)
+}
+
+// CodeLineNumber returns an attribute KeyValue conforming to the "code.lineno"
+// semantic conventions. It represents the line number in `code.filepath` best
+// representing the operation. It SHOULD point within the code unit named in
+// `code.function`.
+func CodeLineNumber(val int) attribute.KeyValue {
+ return CodeLineNumberKey.Int(val)
+}
+
+// CodeColumn returns an attribute KeyValue conforming to the "code.column"
+// semantic conventions. It represents the column number in `code.filepath`
+// best representing the operation. It SHOULD point within the code unit named
+// in `code.function`.
+func CodeColumn(val int) attribute.KeyValue {
+ return CodeColumnKey.Int(val)
+}
+
+// Semantic Convention for HTTP Client
+const (
+ // HTTPResendCountKey is the attribute Key conforming to the
+ // "http.resend_count" semantic conventions. It represents the ordinal
+ // number of request resending attempt (for any reason, including
+ // redirects).
+ //
+ // Type: int
+ // RequirementLevel: Recommended (if and only if request was retried.)
+ // Stability: stable
+ // Examples: 3
+ // Note: The resend count SHOULD be updated each time an HTTP request gets
+ // resent by the client, regardless of what was the cause of the resending
+ // (e.g. redirection, authorization failure, 503 Server Unavailable,
+ // network issues, or any other).
+ HTTPResendCountKey = attribute.Key("http.resend_count")
+)
+
+// HTTPResendCount returns an attribute KeyValue conforming to the
+// "http.resend_count" semantic conventions. It represents the ordinal number
+// of request resending attempt (for any reason, including redirects).
+func HTTPResendCount(val int) attribute.KeyValue {
+ return HTTPResendCountKey.Int(val)
+}
+
+// The `aws` conventions apply to operations using the AWS SDK. They map
+// request or response parameters in AWS SDK API calls to attributes on a Span.
+// The conventions have been collected over time based on feedback from AWS
+// users of tracing and will continue to evolve as new interesting conventions
+// are found.
+// Some descriptions are also provided for populating general OpenTelemetry
+// semantic conventions based on these APIs.
+const (
+ // AWSRequestIDKey is the attribute Key conforming to the "aws.request_id"
+ // semantic conventions. It represents the AWS request ID as returned in
+ // the response headers `x-amz-request-id` or `x-amz-requestid`.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '79b9da39-b7ae-508a-a6bc-864b2829c622', 'C9ER4AJX75574TDJ'
+ AWSRequestIDKey = attribute.Key("aws.request_id")
+)
+
+// AWSRequestID returns an attribute KeyValue conforming to the
+// "aws.request_id" semantic conventions. It represents the AWS request ID as
+// returned in the response headers `x-amz-request-id` or `x-amz-requestid`.
+func AWSRequestID(val string) attribute.KeyValue {
+ return AWSRequestIDKey.String(val)
+}
+
+// Attributes that exist for multiple DynamoDB request types.
+const (
+ // AWSDynamoDBTableNamesKey is the attribute Key conforming to the
+ // "aws.dynamodb.table_names" semantic conventions. It represents the keys
+ // in the `RequestItems` object field.
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Users', 'Cats'
+ AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names")
+
+ // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
+ // JSON-serialized value of each item in the `ConsumedCapacity` response
+ // field.
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '{ "CapacityUnits": number, "GlobalSecondaryIndexes": {
+ // "string" : { "CapacityUnits": number, "ReadCapacityUnits": number,
+ // "WriteCapacityUnits": number } }, "LocalSecondaryIndexes": { "string" :
+ // { "CapacityUnits": number, "ReadCapacityUnits": number,
+ // "WriteCapacityUnits": number } }, "ReadCapacityUnits": number, "Table":
+ // { "CapacityUnits": number, "ReadCapacityUnits": number,
+ // "WriteCapacityUnits": number }, "TableName": "string",
+ // "WriteCapacityUnits": number }'
+ AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity")
+
+ // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to
+ // the "aws.dynamodb.item_collection_metrics" semantic conventions. It
+ // represents the JSON-serialized value of the `ItemCollectionMetrics`
+ // response field.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '{ "string" : [ { "ItemCollectionKey": { "string" : { "B":
+ // blob, "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": {
+ // "string" : "AttributeValue" }, "N": "string", "NS": [ "string" ],
+ // "NULL": boolean, "S": "string", "SS": [ "string" ] } },
+ // "SizeEstimateRangeGB": [ number ] } ] }'
+ AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics")
+
+ // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to
+ // the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It
+ // represents the value of the `ProvisionedThroughput.ReadCapacityUnits`
+ // request parameter.
+ //
+ // Type: double
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 1.0, 2.0
+ AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity")
+
+ // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming
+ // to the "aws.dynamodb.provisioned_write_capacity" semantic conventions.
+ // It represents the value of the
+ // `ProvisionedThroughput.WriteCapacityUnits` request parameter.
+ //
+ // Type: double
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 1.0, 2.0
+ AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity")
+
+ // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the
+ // "aws.dynamodb.consistent_read" semantic conventions. It represents the
+ // value of the `ConsistentRead` request parameter.
+ //
+ // Type: boolean
+ // RequirementLevel: Optional
+ // Stability: stable
+ AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read")
+
+ // AWSDynamoDBProjectionKey is the attribute Key conforming to the
+ // "aws.dynamodb.projection" semantic conventions. It represents the value
+ // of the `ProjectionExpression` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Title', 'Title, Price, Color', 'Title, Description,
+ // RelatedItems, ProductReviews'
+ AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection")
+
+ // AWSDynamoDBLimitKey is the attribute Key conforming to the
+ // "aws.dynamodb.limit" semantic conventions. It represents the value of
+ // the `Limit` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 10
+ AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit")
+
+ // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the
+ // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the
+ // value of the `AttributesToGet` request parameter.
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'lives', 'id'
+ AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get")
+
+ // AWSDynamoDBIndexNameKey is the attribute Key conforming to the
+ // "aws.dynamodb.index_name" semantic conventions. It represents the value
+ // of the `IndexName` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'name_to_group'
+ AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name")
+
+ // AWSDynamoDBSelectKey is the attribute Key conforming to the
+ // "aws.dynamodb.select" semantic conventions. It represents the value of
+ // the `Select` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'ALL_ATTRIBUTES', 'COUNT'
+ AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select")
+)
+
+// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the
+// "aws.dynamodb.table_names" semantic conventions. It represents the keys in
+// the `RequestItems` object field.
+func AWSDynamoDBTableNames(val ...string) attribute.KeyValue {
+ return AWSDynamoDBTableNamesKey.StringSlice(val)
+}
+
+// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to
+// the "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
+// JSON-serialized value of each item in the `ConsumedCapacity` response field.
+func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue {
+ return AWSDynamoDBConsumedCapacityKey.StringSlice(val)
+}
+
+// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming
+// to the "aws.dynamodb.item_collection_metrics" semantic conventions. It
+// represents the JSON-serialized value of the `ItemCollectionMetrics` response
+// field.
+func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue {
+ return AWSDynamoDBItemCollectionMetricsKey.String(val)
+}
+
+// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue
+// conforming to the "aws.dynamodb.provisioned_read_capacity" semantic
+// conventions. It represents the value of the
+// `ProvisionedThroughput.ReadCapacityUnits` request parameter.
+func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue {
+ return AWSDynamoDBProvisionedReadCapacityKey.Float64(val)
+}
+
+// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue
+// conforming to the "aws.dynamodb.provisioned_write_capacity" semantic
+// conventions. It represents the value of the
+// `ProvisionedThroughput.WriteCapacityUnits` request parameter.
+func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue {
+ return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val)
+}
+
+// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the
+// "aws.dynamodb.consistent_read" semantic conventions. It represents the value
+// of the `ConsistentRead` request parameter.
+func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue {
+ return AWSDynamoDBConsistentReadKey.Bool(val)
+}
+
+// AWSDynamoDBProjection returns an attribute KeyValue conforming to the
+// "aws.dynamodb.projection" semantic conventions. It represents the value of
+// the `ProjectionExpression` request parameter.
+func AWSDynamoDBProjection(val string) attribute.KeyValue {
+ return AWSDynamoDBProjectionKey.String(val)
+}
+
+// AWSDynamoDBLimit returns an attribute KeyValue conforming to the
+// "aws.dynamodb.limit" semantic conventions. It represents the value of the
+// `Limit` request parameter.
+func AWSDynamoDBLimit(val int) attribute.KeyValue {
+ return AWSDynamoDBLimitKey.Int(val)
+}
+
+// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to
+// the "aws.dynamodb.attributes_to_get" semantic conventions. It represents the
+// value of the `AttributesToGet` request parameter.
+func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue {
+ return AWSDynamoDBAttributesToGetKey.StringSlice(val)
+}
+
+// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the
+// "aws.dynamodb.index_name" semantic conventions. It represents the value of
+// the `IndexName` request parameter.
+func AWSDynamoDBIndexName(val string) attribute.KeyValue {
+ return AWSDynamoDBIndexNameKey.String(val)
+}
+
+// AWSDynamoDBSelect returns an attribute KeyValue conforming to the
+// "aws.dynamodb.select" semantic conventions. It represents the value of the
+// `Select` request parameter.
+func AWSDynamoDBSelect(val string) attribute.KeyValue {
+ return AWSDynamoDBSelectKey.String(val)
+}
+
+// DynamoDB.CreateTable
+const (
+ // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to
+ // the "aws.dynamodb.global_secondary_indexes" semantic conventions. It
+ // represents the JSON-serialized value of each item of the
+ // `GlobalSecondaryIndexes` request field
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '{ "IndexName": "string", "KeySchema": [ { "AttributeName":
+ // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [
+ // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": {
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }'
+ AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes")
+
+ // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to
+ // the "aws.dynamodb.local_secondary_indexes" semantic conventions. It
+ // represents the JSON-serialized value of each item of the
+ // `LocalSecondaryIndexes` request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '{ "IndexARN": "string", "IndexName": "string",
+ // "IndexSizeBytes": number, "ItemCount": number, "KeySchema": [ {
+ // "AttributeName": "string", "KeyType": "string" } ], "Projection": {
+ // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" } }'
+ AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes")
+)
+
+// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue
+// conforming to the "aws.dynamodb.global_secondary_indexes" semantic
+// conventions. It represents the JSON-serialized value of each item of the
+// `GlobalSecondaryIndexes` request field
+func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue {
+ return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val)
+}
+
+// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming
+// to the "aws.dynamodb.local_secondary_indexes" semantic conventions. It
+// represents the JSON-serialized value of each item of the
+// `LocalSecondaryIndexes` request field.
+func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue {
+ return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val)
+}
+
+// DynamoDB.ListTables
+const (
+ // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the
+ // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents
+ // the value of the `ExclusiveStartTableName` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Users', 'CatsTable'
+ AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table")
+
+ // AWSDynamoDBTableCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.table_count" semantic conventions. It represents the the
+ // number of items in the `TableNames` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 20
+ AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count")
+)
+
+// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming
+// to the "aws.dynamodb.exclusive_start_table" semantic conventions. It
+// represents the value of the `ExclusiveStartTableName` request parameter.
+func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue {
+ return AWSDynamoDBExclusiveStartTableKey.String(val)
+}
+
+// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.table_count" semantic conventions. It represents the the
+// number of items in the `TableNames` response parameter.
+func AWSDynamoDBTableCount(val int) attribute.KeyValue {
+ return AWSDynamoDBTableCountKey.Int(val)
+}
+
+// DynamoDB.Query
+const (
+ // AWSDynamoDBScanForwardKey is the attribute Key conforming to the
+ // "aws.dynamodb.scan_forward" semantic conventions. It represents the
+ // value of the `ScanIndexForward` request parameter.
+ //
+ // Type: boolean
+ // RequirementLevel: Optional
+ // Stability: stable
+ AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward")
+)
+
+// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the
+// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of
+// the `ScanIndexForward` request parameter.
+func AWSDynamoDBScanForward(val bool) attribute.KeyValue {
+ return AWSDynamoDBScanForwardKey.Bool(val)
+}
+
+// DynamoDB.Scan
+const (
+ // AWSDynamoDBSegmentKey is the attribute Key conforming to the
+ // "aws.dynamodb.segment" semantic conventions. It represents the value of
+ // the `Segment` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 10
+ AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment")
+
+ // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the
+ // "aws.dynamodb.total_segments" semantic conventions. It represents the
+ // value of the `TotalSegments` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 100
+ AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments")
+
+ // AWSDynamoDBCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.count" semantic conventions. It represents the value of
+ // the `Count` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 10
+ AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count")
+
+ // AWSDynamoDBScannedCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.scanned_count" semantic conventions. It represents the
+ // value of the `ScannedCount` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 50
+ AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count")
+)
+
+// AWSDynamoDBSegment returns an attribute KeyValue conforming to the
+// "aws.dynamodb.segment" semantic conventions. It represents the value of the
+// `Segment` request parameter.
+func AWSDynamoDBSegment(val int) attribute.KeyValue {
+ return AWSDynamoDBSegmentKey.Int(val)
+}
+
+// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the
+// "aws.dynamodb.total_segments" semantic conventions. It represents the value
+// of the `TotalSegments` request parameter.
+func AWSDynamoDBTotalSegments(val int) attribute.KeyValue {
+ return AWSDynamoDBTotalSegmentsKey.Int(val)
+}
+
+// AWSDynamoDBCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.count" semantic conventions. It represents the value of the
+// `Count` response parameter.
+func AWSDynamoDBCount(val int) attribute.KeyValue {
+ return AWSDynamoDBCountKey.Int(val)
+}
+
+// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.scanned_count" semantic conventions. It represents the value
+// of the `ScannedCount` response parameter.
+func AWSDynamoDBScannedCount(val int) attribute.KeyValue {
+ return AWSDynamoDBScannedCountKey.Int(val)
+}
+
+// DynamoDB.UpdateTable
+const (
+ // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to
+ // the "aws.dynamodb.attribute_definitions" semantic conventions. It
+ // represents the JSON-serialized value of each item in the
+ // `AttributeDefinitions` request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '{ "AttributeName": "string", "AttributeType": "string" }'
+ AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions")
+
+ // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key
+ // conforming to the "aws.dynamodb.global_secondary_index_updates" semantic
+ // conventions. It represents the JSON-serialized value of each item in the
+ // the `GlobalSecondaryIndexUpdates` request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '{ "Create": { "IndexName": "string", "KeySchema": [ {
+ // "AttributeName": "string", "KeyType": "string" } ], "Projection": {
+ // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" },
+ // "ProvisionedThroughput": { "ReadCapacityUnits": number,
+ // "WriteCapacityUnits": number } }'
+ AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates")
+)
+
+// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming
+// to the "aws.dynamodb.attribute_definitions" semantic conventions. It
+// represents the JSON-serialized value of each item in the
+// `AttributeDefinitions` request field.
+func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue {
+ return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val)
+}
+
+// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue
+// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic
+// conventions. It represents the JSON-serialized value of each item in the the
+// `GlobalSecondaryIndexUpdates` request field.
+func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue {
+ return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val)
+}
+
+// Attributes that exist for S3 request types.
+const (
+ // AWSS3BucketKey is the attribute Key conforming to the "aws.s3.bucket"
+ // semantic conventions. It represents the S3 bucket name the request
+ // refers to. Corresponds to the `--bucket` parameter of the [S3
+ // API](https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html)
+ // operations.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'some-bucket-name'
+ // Note: The `bucket` attribute is applicable to all S3 operations that
+ // reference a bucket, i.e. that require the bucket name as a mandatory
+ // parameter.
+ // This applies to almost all S3 operations except `list-buckets`.
+ AWSS3BucketKey = attribute.Key("aws.s3.bucket")
+
+ // AWSS3KeyKey is the attribute Key conforming to the "aws.s3.key" semantic
+ // conventions. It represents the S3 object key the request refers to.
+ // Corresponds to the `--key` parameter of the [S3
+ // API](https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html)
+ // operations.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'someFile.yml'
+ // Note: The `key` attribute is applicable to all object-related S3
+ // operations, i.e. that require the object key as a mandatory parameter.
+ // This applies in particular to the following operations:
+ //
+ // -
+ // [copy-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html)
+ // -
+ // [delete-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html)
+ // -
+ // [get-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/get-object.html)
+ // -
+ // [head-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/head-object.html)
+ // -
+ // [put-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/put-object.html)
+ // -
+ // [restore-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/restore-object.html)
+ // -
+ // [select-object-content](https://docs.aws.amazon.com/cli/latest/reference/s3api/select-object-content.html)
+ // -
+ // [abort-multipart-upload](https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html)
+ // -
+ // [complete-multipart-upload](https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html)
+ // -
+ // [create-multipart-upload](https://docs.aws.amazon.com/cli/latest/reference/s3api/create-multipart-upload.html)
+ // -
+ // [list-parts](https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html)
+ // -
+ // [upload-part](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html)
+ // -
+ // [upload-part-copy](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html)
+ AWSS3KeyKey = attribute.Key("aws.s3.key")
+
+ // AWSS3CopySourceKey is the attribute Key conforming to the
+ // "aws.s3.copy_source" semantic conventions. It represents the source
+ // object (in the form `bucket`/`key`) for the copy operation.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'someFile.yml'
+ // Note: The `copy_source` attribute applies to S3 copy operations and
+ // corresponds to the `--copy-source` parameter
+ // of the [copy-object operation within the S3
+ // API](https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html).
+ // This applies in particular to the following operations:
+ //
+ // -
+ // [copy-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html)
+ // -
+ // [upload-part-copy](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html)
+ AWSS3CopySourceKey = attribute.Key("aws.s3.copy_source")
+
+ // AWSS3UploadIDKey is the attribute Key conforming to the
+ // "aws.s3.upload_id" semantic conventions. It represents the upload ID
+ // that identifies the multipart upload.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'dfRtDYWFbkRONycy.Yxwh66Yjlx.cph0gtNBtJ'
+ // Note: The `upload_id` attribute applies to S3 multipart-upload
+ // operations and corresponds to the `--upload-id` parameter
+ // of the [S3
+ // API](https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html)
+ // multipart operations.
+ // This applies in particular to the following operations:
+ //
+ // -
+ // [abort-multipart-upload](https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html)
+ // -
+ // [complete-multipart-upload](https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html)
+ // -
+ // [list-parts](https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html)
+ // -
+ // [upload-part](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html)
+ // -
+ // [upload-part-copy](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html)
+ AWSS3UploadIDKey = attribute.Key("aws.s3.upload_id")
+
+ // AWSS3DeleteKey is the attribute Key conforming to the "aws.s3.delete"
+ // semantic conventions. It represents the delete request container that
+ // specifies the objects to be deleted.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples:
+ // 'Objects=[{Key=string,VersionID=string},{Key=string,VersionID=string}],Quiet=boolean'
+ // Note: The `delete` attribute is only applicable to the
+ // [delete-object](https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html)
+ // operation.
+ // The `delete` attribute corresponds to the `--delete` parameter of the
+ // [delete-objects operation within the S3
+ // API](https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-objects.html).
+ AWSS3DeleteKey = attribute.Key("aws.s3.delete")
+
+ // AWSS3PartNumberKey is the attribute Key conforming to the
+ // "aws.s3.part_number" semantic conventions. It represents the part number
+ // of the part being uploaded in a multipart-upload operation. This is a
+ // positive integer between 1 and 10,000.
+ //
+ // Type: int
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 3456
+ // Note: The `part_number` attribute is only applicable to the
+ // [upload-part](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html)
+ // and
+ // [upload-part-copy](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html)
+ // operations.
+ // The `part_number` attribute corresponds to the `--part-number` parameter
+ // of the
+ // [upload-part operation within the S3
+ // API](https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html).
+ AWSS3PartNumberKey = attribute.Key("aws.s3.part_number")
+)
+
+// AWSS3Bucket returns an attribute KeyValue conforming to the
+// "aws.s3.bucket" semantic conventions. It represents the S3 bucket name the
+// request refers to. Corresponds to the `--bucket` parameter of the [S3
+// API](https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html)
+// operations.
+func AWSS3Bucket(val string) attribute.KeyValue {
+ return AWSS3BucketKey.String(val)
+}
+
+// AWSS3Key returns an attribute KeyValue conforming to the "aws.s3.key"
+// semantic conventions. It represents the S3 object key the request refers to.
+// Corresponds to the `--key` parameter of the [S3
+// API](https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html)
+// operations.
+func AWSS3Key(val string) attribute.KeyValue {
+ return AWSS3KeyKey.String(val)
+}
+
+// AWSS3CopySource returns an attribute KeyValue conforming to the
+// "aws.s3.copy_source" semantic conventions. It represents the source object
+// (in the form `bucket`/`key`) for the copy operation.
+func AWSS3CopySource(val string) attribute.KeyValue {
+ return AWSS3CopySourceKey.String(val)
+}
+
+// AWSS3UploadID returns an attribute KeyValue conforming to the
+// "aws.s3.upload_id" semantic conventions. It represents the upload ID that
+// identifies the multipart upload.
+func AWSS3UploadID(val string) attribute.KeyValue {
+ return AWSS3UploadIDKey.String(val)
+}
+
+// AWSS3Delete returns an attribute KeyValue conforming to the
+// "aws.s3.delete" semantic conventions. It represents the delete request
+// container that specifies the objects to be deleted.
+func AWSS3Delete(val string) attribute.KeyValue {
+ return AWSS3DeleteKey.String(val)
+}
+
+// AWSS3PartNumber returns an attribute KeyValue conforming to the
+// "aws.s3.part_number" semantic conventions. It represents the part number of
+// the part being uploaded in a multipart-upload operation. This is a positive
+// integer between 1 and 10,000.
+func AWSS3PartNumber(val int) attribute.KeyValue {
+ return AWSS3PartNumberKey.Int(val)
+}
+
+// Semantic conventions to apply when instrumenting the GraphQL implementation.
+// They map GraphQL operations to attributes on a Span.
+const (
+ // GraphqlOperationNameKey is the attribute Key conforming to the
+ // "graphql.operation.name" semantic conventions. It represents the name of
+ // the operation being executed.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'findBookByID'
+ GraphqlOperationNameKey = attribute.Key("graphql.operation.name")
+
+ // GraphqlOperationTypeKey is the attribute Key conforming to the
+ // "graphql.operation.type" semantic conventions. It represents the type of
+ // the operation being executed.
+ //
+ // Type: Enum
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'query', 'mutation', 'subscription'
+ GraphqlOperationTypeKey = attribute.Key("graphql.operation.type")
+
+ // GraphqlDocumentKey is the attribute Key conforming to the
+ // "graphql.document" semantic conventions. It represents the GraphQL
+ // document being executed.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'query findBookByID { bookByID(id: ?) { name } }'
+ // Note: The value may be sanitized to exclude sensitive information.
+ GraphqlDocumentKey = attribute.Key("graphql.document")
+)
+
+var (
+ // GraphQL query
+ GraphqlOperationTypeQuery = GraphqlOperationTypeKey.String("query")
+ // GraphQL mutation
+ GraphqlOperationTypeMutation = GraphqlOperationTypeKey.String("mutation")
+ // GraphQL subscription
+ GraphqlOperationTypeSubscription = GraphqlOperationTypeKey.String("subscription")
+)
+
+// GraphqlOperationName returns an attribute KeyValue conforming to the
+// "graphql.operation.name" semantic conventions. It represents the name of the
+// operation being executed.
+func GraphqlOperationName(val string) attribute.KeyValue {
+ return GraphqlOperationNameKey.String(val)
+}
+
+// GraphqlDocument returns an attribute KeyValue conforming to the
+// "graphql.document" semantic conventions. It represents the GraphQL document
+// being executed.
+func GraphqlDocument(val string) attribute.KeyValue {
+ return GraphqlDocumentKey.String(val)
+}
+
+// General attributes used in messaging systems.
+const (
+ // MessagingSystemKey is the attribute Key conforming to the
+ // "messaging.system" semantic conventions. It represents a string
+ // identifying the messaging system.
+ //
+ // Type: string
+ // RequirementLevel: Required
+ // Stability: stable
+ // Examples: 'kafka', 'rabbitmq', 'rocketmq', 'activemq', 'AmazonSQS'
+ MessagingSystemKey = attribute.Key("messaging.system")
+
+ // MessagingOperationKey is the attribute Key conforming to the
+ // "messaging.operation" semantic conventions. It represents a string
+ // identifying the kind of messaging operation as defined in the [Operation
+ // names](#operation-names) section above.
+ //
+ // Type: Enum
+ // RequirementLevel: Required
+ // Stability: stable
+ // Note: If a custom value is used, it MUST be of low cardinality.
+ MessagingOperationKey = attribute.Key("messaging.operation")
+
+ // MessagingBatchMessageCountKey is the attribute Key conforming to the
+ // "messaging.batch.message_count" semantic conventions. It represents the
+ // number of messages sent, received, or processed in the scope of the
+ // batching operation.
+ //
+ // Type: int
+ // RequirementLevel: ConditionallyRequired (If the span describes an
+ // operation on a batch of messages.)
+ // Stability: stable
+ // Examples: 0, 1, 2
+ // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on
+ // spans that operate with a single message. When a messaging client
+ // library supports both batch and single-message API for the same
+ // operation, instrumentations SHOULD use `messaging.batch.message_count`
+ // for batching APIs and SHOULD NOT use it for single-message APIs.
+ MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count")
+
+ // MessagingClientIDKey is the attribute Key conforming to the
+ // "messaging.client_id" semantic conventions. It represents a unique
+ // identifier for the client that consumes or produces a message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended (If a client id is available)
+ // Stability: stable
+ // Examples: 'client-5', 'myhost@8742@s8083jm'
+ MessagingClientIDKey = attribute.Key("messaging.client_id")
+)
+
+var (
+ // publish
+ MessagingOperationPublish = MessagingOperationKey.String("publish")
+ // receive
+ MessagingOperationReceive = MessagingOperationKey.String("receive")
+ // process
+ MessagingOperationProcess = MessagingOperationKey.String("process")
+)
+
+// MessagingSystem returns an attribute KeyValue conforming to the
+// "messaging.system" semantic conventions. It represents a string identifying
+// the messaging system.
+func MessagingSystem(val string) attribute.KeyValue {
+ return MessagingSystemKey.String(val)
+}
+
+// MessagingBatchMessageCount returns an attribute KeyValue conforming to
+// the "messaging.batch.message_count" semantic conventions. It represents the
+// number of messages sent, received, or processed in the scope of the batching
+// operation.
+func MessagingBatchMessageCount(val int) attribute.KeyValue {
+ return MessagingBatchMessageCountKey.Int(val)
+}
+
+// MessagingClientID returns an attribute KeyValue conforming to the
+// "messaging.client_id" semantic conventions. It represents a unique
+// identifier for the client that consumes or produces a message.
+func MessagingClientID(val string) attribute.KeyValue {
+ return MessagingClientIDKey.String(val)
+}
+
+// Semantic conventions for remote procedure calls.
+const (
+ // RPCSystemKey is the attribute Key conforming to the "rpc.system"
+ // semantic conventions. It represents a string identifying the remoting
+ // system. See below for a list of well-known identifiers.
+ //
+ // Type: Enum
+ // RequirementLevel: Required
+ // Stability: stable
+ RPCSystemKey = attribute.Key("rpc.system")
+
+ // RPCServiceKey is the attribute Key conforming to the "rpc.service"
+ // semantic conventions. It represents the full (logical) name of the
+ // service being called, including its package name, if applicable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: stable
+ // Examples: 'myservice.EchoService'
+ // Note: This is the logical name of the service from the RPC interface
+ // perspective, which can be different from the name of any implementing
+ // class. The `code.namespace` attribute may be used to store the latter
+ // (despite the attribute name, it may include a class name; e.g., class
+ // with method actually executing the call on the server side, RPC client
+ // stub class on the client side).
+ RPCServiceKey = attribute.Key("rpc.service")
+
+ // RPCMethodKey is the attribute Key conforming to the "rpc.method"
+ // semantic conventions. It represents the name of the (logical) method
+ // being called, must be equal to the $method part in the span name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: stable
+ // Examples: 'exampleMethod'
+ // Note: This is the logical name of the method from the RPC interface
+ // perspective, which can be different from the name of any implementing
+ // method/function. The `code.function` attribute may be used to store the
+ // latter (e.g., method actually executing the call on the server side, RPC
+ // client stub method on the client side).
+ RPCMethodKey = attribute.Key("rpc.method")
+)
+
+var (
+ // gRPC
+ RPCSystemGRPC = RPCSystemKey.String("grpc")
+ // Java RMI
+ RPCSystemJavaRmi = RPCSystemKey.String("java_rmi")
+ // .NET WCF
+ RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf")
+ // Apache Dubbo
+ RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo")
+ // Connect RPC
+ RPCSystemConnectRPC = RPCSystemKey.String("connect_rpc")
+)
+
+// RPCService returns an attribute KeyValue conforming to the "rpc.service"
+// semantic conventions. It represents the full (logical) name of the service
+// being called, including its package name, if applicable.
+func RPCService(val string) attribute.KeyValue {
+ return RPCServiceKey.String(val)
+}
+
+// RPCMethod returns an attribute KeyValue conforming to the "rpc.method"
+// semantic conventions. It represents the name of the (logical) method being
+// called, must be equal to the $method part in the span name.
+func RPCMethod(val string) attribute.KeyValue {
+ return RPCMethodKey.String(val)
+}
+
+// Tech-specific attributes for gRPC.
+const (
+ // RPCGRPCStatusCodeKey is the attribute Key conforming to the
+ // "rpc.grpc.status_code" semantic conventions. It represents the [numeric
+ // status
+ // code](https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md) of
+ // the gRPC request.
+ //
+ // Type: Enum
+ // RequirementLevel: Required
+ // Stability: stable
+ RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code")
+)
+
+var (
+ // OK
+ RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0)
+ // CANCELLED
+ RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1)
+ // UNKNOWN
+ RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2)
+ // INVALID_ARGUMENT
+ RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3)
+ // DEADLINE_EXCEEDED
+ RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4)
+ // NOT_FOUND
+ RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5)
+ // ALREADY_EXISTS
+ RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6)
+ // PERMISSION_DENIED
+ RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7)
+ // RESOURCE_EXHAUSTED
+ RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8)
+ // FAILED_PRECONDITION
+ RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9)
+ // ABORTED
+ RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10)
+ // OUT_OF_RANGE
+ RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11)
+ // UNIMPLEMENTED
+ RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12)
+ // INTERNAL
+ RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13)
+ // UNAVAILABLE
+ RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14)
+ // DATA_LOSS
+ RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15)
+ // UNAUTHENTICATED
+ RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16)
+)
+
+// Tech-specific attributes for [JSON RPC](https://www.jsonrpc.org/).
+const (
+ // RPCJsonrpcVersionKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.version" semantic conventions. It represents the protocol
+ // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0
+ // does not specify this, the value can be omitted.
+ //
+ // Type: string
+ // RequirementLevel: ConditionallyRequired (If other than the default
+ // version (`1.0`))
+ // Stability: stable
+ // Examples: '2.0', '1.0'
+ RPCJsonrpcVersionKey = attribute.Key("rpc.jsonrpc.version")
+
+ // RPCJsonrpcRequestIDKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id`
+ // property of request or response. Since protocol allows id to be int,
+ // string, `null` or missing (for notifications), value is expected to be
+ // cast to string for simplicity. Use empty string in case of `null` value.
+ // Omit entirely if this is a notification.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: '10', 'request-7', ''
+ RPCJsonrpcRequestIDKey = attribute.Key("rpc.jsonrpc.request_id")
+
+ // RPCJsonrpcErrorCodeKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.error_code" semantic conventions. It represents the
+ // `error.code` property of response if it is an error response.
+ //
+ // Type: int
+ // RequirementLevel: ConditionallyRequired (If response is not successful.)
+ // Stability: stable
+ // Examples: -32700, 100
+ RPCJsonrpcErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code")
+
+ // RPCJsonrpcErrorMessageKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.error_message" semantic conventions. It represents the
+ // `error.message` property of response if it is an error response.
+ //
+ // Type: string
+ // RequirementLevel: Optional
+ // Stability: stable
+ // Examples: 'Parse error', 'User already exists'
+ RPCJsonrpcErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message")
+)
+
+// RPCJsonrpcVersion returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.version" semantic conventions. It represents the protocol
+// version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0
+// does not specify this, the value can be omitted.
+func RPCJsonrpcVersion(val string) attribute.KeyValue {
+ return RPCJsonrpcVersionKey.String(val)
+}
+
+// RPCJsonrpcRequestID returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id`
+// property of request or response. Since protocol allows id to be int, string,
+// `null` or missing (for notifications), value is expected to be cast to
+// string for simplicity. Use empty string in case of `null` value. Omit
+// entirely if this is a notification.
+func RPCJsonrpcRequestID(val string) attribute.KeyValue {
+ return RPCJsonrpcRequestIDKey.String(val)
+}
+
+// RPCJsonrpcErrorCode returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.error_code" semantic conventions. It represents the
+// `error.code` property of response if it is an error response.
+func RPCJsonrpcErrorCode(val int) attribute.KeyValue {
+ return RPCJsonrpcErrorCodeKey.Int(val)
+}
+
+// RPCJsonrpcErrorMessage returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.error_message" semantic conventions. It represents the
+// `error.message` property of response if it is an error response.
+func RPCJsonrpcErrorMessage(val string) attribute.KeyValue {
+ return RPCJsonrpcErrorMessageKey.String(val)
+}
+
+// Tech-specific attributes for Connect RPC.
+const (
+ // RPCConnectRPCErrorCodeKey is the attribute Key conforming to the
+ // "rpc.connect_rpc.error_code" semantic conventions. It represents the
+ // [error codes](https://connect.build/docs/protocol/#error-codes) of the
+ // Connect request. Error codes are always string values.
+ //
+ // Type: Enum
+ // RequirementLevel: ConditionallyRequired (If response is not successful
+ // and if error code available.)
+ // Stability: stable
+ RPCConnectRPCErrorCodeKey = attribute.Key("rpc.connect_rpc.error_code")
+)
+
+var (
+ // cancelled
+ RPCConnectRPCErrorCodeCancelled = RPCConnectRPCErrorCodeKey.String("cancelled")
+ // unknown
+ RPCConnectRPCErrorCodeUnknown = RPCConnectRPCErrorCodeKey.String("unknown")
+ // invalid_argument
+ RPCConnectRPCErrorCodeInvalidArgument = RPCConnectRPCErrorCodeKey.String("invalid_argument")
+ // deadline_exceeded
+ RPCConnectRPCErrorCodeDeadlineExceeded = RPCConnectRPCErrorCodeKey.String("deadline_exceeded")
+ // not_found
+ RPCConnectRPCErrorCodeNotFound = RPCConnectRPCErrorCodeKey.String("not_found")
+ // already_exists
+ RPCConnectRPCErrorCodeAlreadyExists = RPCConnectRPCErrorCodeKey.String("already_exists")
+ // permission_denied
+ RPCConnectRPCErrorCodePermissionDenied = RPCConnectRPCErrorCodeKey.String("permission_denied")
+ // resource_exhausted
+ RPCConnectRPCErrorCodeResourceExhausted = RPCConnectRPCErrorCodeKey.String("resource_exhausted")
+ // failed_precondition
+ RPCConnectRPCErrorCodeFailedPrecondition = RPCConnectRPCErrorCodeKey.String("failed_precondition")
+ // aborted
+ RPCConnectRPCErrorCodeAborted = RPCConnectRPCErrorCodeKey.String("aborted")
+ // out_of_range
+ RPCConnectRPCErrorCodeOutOfRange = RPCConnectRPCErrorCodeKey.String("out_of_range")
+ // unimplemented
+ RPCConnectRPCErrorCodeUnimplemented = RPCConnectRPCErrorCodeKey.String("unimplemented")
+ // internal
+ RPCConnectRPCErrorCodeInternal = RPCConnectRPCErrorCodeKey.String("internal")
+ // unavailable
+ RPCConnectRPCErrorCodeUnavailable = RPCConnectRPCErrorCodeKey.String("unavailable")
+ // data_loss
+ RPCConnectRPCErrorCodeDataLoss = RPCConnectRPCErrorCodeKey.String("data_loss")
+ // unauthenticated
+ RPCConnectRPCErrorCodeUnauthenticated = RPCConnectRPCErrorCodeKey.String("unauthenticated")
+)
diff --git a/vendor/go.opentelemetry.io/otel/trace/config.go b/vendor/go.opentelemetry.io/otel/trace/config.go
index f058cc781..cb3efbb9a 100644
--- a/vendor/go.opentelemetry.io/otel/trace/config.go
+++ b/vendor/go.opentelemetry.io/otel/trace/config.go
@@ -25,6 +25,7 @@ type TracerConfig struct {
instrumentationVersion string
// Schema URL of the telemetry emitted by the Tracer.
schemaURL string
+ attrs attribute.Set
}
// InstrumentationVersion returns the version of the library providing instrumentation.
@@ -32,6 +33,12 @@ func (t *TracerConfig) InstrumentationVersion() string {
return t.instrumentationVersion
}
+// InstrumentationAttributes returns the attributes associated with the library
+// providing instrumentation.
+func (t *TracerConfig) InstrumentationAttributes() attribute.Set {
+ return t.attrs
+}
+
// SchemaURL returns the Schema URL of the telemetry emitted by the Tracer.
func (t *TracerConfig) SchemaURL() string {
return t.schemaURL
@@ -307,6 +314,16 @@ func WithInstrumentationVersion(version string) TracerOption {
})
}
+// WithInstrumentationAttributes sets the instrumentation attributes.
+//
+// The passed attributes will be de-duplicated.
+func WithInstrumentationAttributes(attr ...attribute.KeyValue) TracerOption {
+ return tracerOptionFunc(func(config TracerConfig) TracerConfig {
+ config.attrs = attribute.NewSet(attr...)
+ return config
+ })
+}
+
// WithSchemaURL sets the schema URL for the Tracer.
func WithSchemaURL(schemaURL string) TracerOption {
return tracerOptionFunc(func(cfg TracerConfig) TracerConfig {
diff --git a/vendor/go.opentelemetry.io/otel/trace/doc.go b/vendor/go.opentelemetry.io/otel/trace/doc.go
index 391417718..ab0346f96 100644
--- a/vendor/go.opentelemetry.io/otel/trace/doc.go
+++ b/vendor/go.opentelemetry.io/otel/trace/doc.go
@@ -17,7 +17,7 @@ Package trace provides an implementation of the tracing part of the
OpenTelemetry API.
To participate in distributed traces a Span needs to be created for the
-operation being performed as part of a traced workflow. It its simplest form:
+operation being performed as part of a traced workflow. In its simplest form:
var tracer trace.Tracer
diff --git a/vendor/go.opentelemetry.io/otel/trace/noop.go b/vendor/go.opentelemetry.io/otel/trace/noop.go
index 73950f207..7cf6c7f3e 100644
--- a/vendor/go.opentelemetry.io/otel/trace/noop.go
+++ b/vendor/go.opentelemetry.io/otel/trace/noop.go
@@ -37,7 +37,7 @@ func (p noopTracerProvider) Tracer(string, ...TracerOption) Tracer {
return noopTracer{}
}
-// noopTracer is an implementation of Tracer that preforms no operations.
+// noopTracer is an implementation of Tracer that performs no operations.
type noopTracer struct{}
var _ Tracer = noopTracer{}
@@ -53,7 +53,7 @@ func (t noopTracer) Start(ctx context.Context, name string, _ ...SpanStartOption
return ContextWithSpan(ctx, span), span
}
-// noopSpan is an implementation of Span that preforms no operations.
+// noopSpan is an implementation of Span that performs no operations.
type noopSpan struct{}
var _ Span = noopSpan{}
diff --git a/vendor/go.opentelemetry.io/otel/trace/trace.go b/vendor/go.opentelemetry.io/otel/trace/trace.go
index 97f3d8385..4aa94f79f 100644
--- a/vendor/go.opentelemetry.io/otel/trace/trace.go
+++ b/vendor/go.opentelemetry.io/otel/trace/trace.go
@@ -364,8 +364,9 @@ type Span interface {
SpanContext() SpanContext
// SetStatus sets the status of the Span in the form of a code and a
- // description, overriding previous values set. The description is only
- // included in a status when the code is for an error.
+ // description, provided the status hasn't already been set to a higher
+ // value before (OK > Error > Unset). The description is only included in a
+ // status when the code is for an error.
SetStatus(code codes.Code, description string)
// SetName sets the Span name.
diff --git a/vendor/go.opentelemetry.io/otel/version.go b/vendor/go.opentelemetry.io/otel/version.go
index 806db41c5..ad64e1996 100644
--- a/vendor/go.opentelemetry.io/otel/version.go
+++ b/vendor/go.opentelemetry.io/otel/version.go
@@ -16,5 +16,5 @@ package otel // import "go.opentelemetry.io/otel"
// Version is the current release version of OpenTelemetry in use.
func Version() string {
- return "1.10.0"
+ return "1.19.0"
}
diff --git a/vendor/go.opentelemetry.io/otel/versions.yaml b/vendor/go.opentelemetry.io/otel/versions.yaml
index ec2ca16d2..7d2127692 100644
--- a/vendor/go.opentelemetry.io/otel/versions.yaml
+++ b/vendor/go.opentelemetry.io/otel/versions.yaml
@@ -14,45 +14,42 @@
module-sets:
stable-v1:
- version: v1.10.0
+ version: v1.19.0
modules:
- go.opentelemetry.io/otel
- go.opentelemetry.io/otel/bridge/opentracing
+ - go.opentelemetry.io/otel/bridge/opentracing/test
+ - go.opentelemetry.io/otel/example/dice
- go.opentelemetry.io/otel/example/fib
- - go.opentelemetry.io/otel/example/jaeger
- go.opentelemetry.io/otel/example/namedtracer
- go.opentelemetry.io/otel/example/otel-collector
- go.opentelemetry.io/otel/example/passthrough
- go.opentelemetry.io/otel/example/zipkin
- - go.opentelemetry.io/otel/exporters/jaeger
- - go.opentelemetry.io/otel/exporters/zipkin
- go.opentelemetry.io/otel/exporters/otlp/otlptrace
- go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc
- go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp
- - go.opentelemetry.io/otel/exporters/otlp/internal/retry
- go.opentelemetry.io/otel/exporters/stdout/stdouttrace
- - go.opentelemetry.io/otel/trace
+ - go.opentelemetry.io/otel/exporters/zipkin
+ - go.opentelemetry.io/otel/metric
- go.opentelemetry.io/otel/sdk
+ - go.opentelemetry.io/otel/sdk/metric
+ - go.opentelemetry.io/otel/trace
experimental-metrics:
- version: v0.31.0
+ version: v0.42.0
modules:
+ - go.opentelemetry.io/otel/bridge/opencensus
+ - go.opentelemetry.io/otel/bridge/opencensus/test
+ - go.opentelemetry.io/otel/example/opencensus
- go.opentelemetry.io/otel/example/prometheus
+ - go.opentelemetry.io/otel/example/view
- go.opentelemetry.io/otel/exporters/otlp/otlpmetric
- go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc
- go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp
- go.opentelemetry.io/otel/exporters/prometheus
- go.opentelemetry.io/otel/exporters/stdout/stdoutmetric
- - go.opentelemetry.io/otel/metric
- - go.opentelemetry.io/otel/sdk/metric
experimental-schema:
- version: v0.0.3
+ version: v0.0.7
modules:
- go.opentelemetry.io/otel/schema
- bridge:
- version: v0.31.0
- modules:
- - go.opentelemetry.io/otel/bridge/opencensus
- - go.opentelemetry.io/otel/bridge/opencensus/test
- - go.opentelemetry.io/otel/example/opencensus
excluded-modules:
- go.opentelemetry.io/otel/internal/tools
diff --git a/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.go b/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.go
index fc285c089..c1af04e84 100644
--- a/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.go
+++ b/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.go
@@ -15,7 +15,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
// protoc-gen-go v1.26.0
-// protoc v3.17.3
+// protoc v3.21.6
// source: opentelemetry/proto/collector/trace/v1/trace_service.proto
package v1
diff --git a/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.gw.go b/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.gw.go
index d142c2a44..bb1bd261e 100644
--- a/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.gw.go
+++ b/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service.pb.gw.go
@@ -77,20 +77,22 @@ func RegisterTraceServiceHandlerServer(ctx context.Context, mux *runtime.ServeMu
var stream runtime.ServerTransportStream
ctx = grpc.NewContextWithServerTransportStream(ctx, &stream)
inboundMarshaler, outboundMarshaler := runtime.MarshalerForRequest(mux, req)
- rctx, err := runtime.AnnotateIncomingContext(ctx, mux, req, "/opentelemetry.proto.collector.trace.v1.TraceService/Export", runtime.WithHTTPPathPattern("/v1/trace"))
+ var err error
+ var annotatedContext context.Context
+ annotatedContext, err = runtime.AnnotateIncomingContext(ctx, mux, req, "/opentelemetry.proto.collector.trace.v1.TraceService/Export", runtime.WithHTTPPathPattern("/v1/traces"))
if err != nil {
runtime.HTTPError(ctx, mux, outboundMarshaler, w, req, err)
return
}
- resp, md, err := local_request_TraceService_Export_0(rctx, inboundMarshaler, server, req, pathParams)
+ resp, md, err := local_request_TraceService_Export_0(annotatedContext, inboundMarshaler, server, req, pathParams)
md.HeaderMD, md.TrailerMD = metadata.Join(md.HeaderMD, stream.Header()), metadata.Join(md.TrailerMD, stream.Trailer())
- ctx = runtime.NewServerMetadataContext(ctx, md)
+ annotatedContext = runtime.NewServerMetadataContext(annotatedContext, md)
if err != nil {
- runtime.HTTPError(ctx, mux, outboundMarshaler, w, req, err)
+ runtime.HTTPError(annotatedContext, mux, outboundMarshaler, w, req, err)
return
}
- forward_TraceService_Export_0(ctx, mux, outboundMarshaler, w, req, resp, mux.GetForwardResponseOptions()...)
+ forward_TraceService_Export_0(annotatedContext, mux, outboundMarshaler, w, req, resp, mux.GetForwardResponseOptions()...)
})
@@ -139,19 +141,21 @@ func RegisterTraceServiceHandlerClient(ctx context.Context, mux *runtime.ServeMu
ctx, cancel := context.WithCancel(req.Context())
defer cancel()
inboundMarshaler, outboundMarshaler := runtime.MarshalerForRequest(mux, req)
- rctx, err := runtime.AnnotateContext(ctx, mux, req, "/opentelemetry.proto.collector.trace.v1.TraceService/Export", runtime.WithHTTPPathPattern("/v1/trace"))
+ var err error
+ var annotatedContext context.Context
+ annotatedContext, err = runtime.AnnotateContext(ctx, mux, req, "/opentelemetry.proto.collector.trace.v1.TraceService/Export", runtime.WithHTTPPathPattern("/v1/traces"))
if err != nil {
runtime.HTTPError(ctx, mux, outboundMarshaler, w, req, err)
return
}
- resp, md, err := request_TraceService_Export_0(rctx, inboundMarshaler, client, req, pathParams)
- ctx = runtime.NewServerMetadataContext(ctx, md)
+ resp, md, err := request_TraceService_Export_0(annotatedContext, inboundMarshaler, client, req, pathParams)
+ annotatedContext = runtime.NewServerMetadataContext(annotatedContext, md)
if err != nil {
- runtime.HTTPError(ctx, mux, outboundMarshaler, w, req, err)
+ runtime.HTTPError(annotatedContext, mux, outboundMarshaler, w, req, err)
return
}
- forward_TraceService_Export_0(ctx, mux, outboundMarshaler, w, req, resp, mux.GetForwardResponseOptions()...)
+ forward_TraceService_Export_0(annotatedContext, mux, outboundMarshaler, w, req, resp, mux.GetForwardResponseOptions()...)
})
@@ -159,7 +163,7 @@ func RegisterTraceServiceHandlerClient(ctx context.Context, mux *runtime.ServeMu
}
var (
- pattern_TraceService_Export_0 = runtime.MustPattern(runtime.NewPattern(1, []int{2, 0, 2, 1}, []string{"v1", "trace"}, ""))
+ pattern_TraceService_Export_0 = runtime.MustPattern(runtime.NewPattern(1, []int{2, 0, 2, 1}, []string{"v1", "traces"}, ""))
)
var (
diff --git a/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service_grpc.pb.go b/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service_grpc.pb.go
index c21f2cb47..dd1b73f1e 100644
--- a/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service_grpc.pb.go
+++ b/vendor/go.opentelemetry.io/proto/otlp/collector/trace/v1/trace_service_grpc.pb.go
@@ -1,7 +1,7 @@
// Code generated by protoc-gen-go-grpc. DO NOT EDIT.
// versions:
// - protoc-gen-go-grpc v1.1.0
-// - protoc v3.17.3
+// - protoc v3.21.6
// source: opentelemetry/proto/collector/trace/v1/trace_service.proto
package v1
diff --git a/vendor/go.opentelemetry.io/proto/otlp/common/v1/common.pb.go b/vendor/go.opentelemetry.io/proto/otlp/common/v1/common.pb.go
index 8502e607b..852209b09 100644
--- a/vendor/go.opentelemetry.io/proto/otlp/common/v1/common.pb.go
+++ b/vendor/go.opentelemetry.io/proto/otlp/common/v1/common.pb.go
@@ -15,7 +15,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
// protoc-gen-go v1.26.0
-// protoc v3.17.3
+// protoc v3.21.6
// source: opentelemetry/proto/common/v1/common.proto
package v1
@@ -361,8 +361,11 @@ type InstrumentationScope struct {
unknownFields protoimpl.UnknownFields
// An empty instrumentation scope name means the name is unknown.
- Name string `protobuf:"bytes,1,opt,name=name,proto3" json:"name,omitempty"`
- Version string `protobuf:"bytes,2,opt,name=version,proto3" json:"version,omitempty"`
+ Name string `protobuf:"bytes,1,opt,name=name,proto3" json:"name,omitempty"`
+ Version string `protobuf:"bytes,2,opt,name=version,proto3" json:"version,omitempty"`
+ // Additional attributes that describe the scope. [Optional].
+ // Attribute keys MUST be unique (it is not allowed to have more than one
+ // attribute with the same key).
Attributes []*KeyValue `protobuf:"bytes,3,rep,name=attributes,proto3" json:"attributes,omitempty"`
DroppedAttributesCount uint32 `protobuf:"varint,4,opt,name=dropped_attributes_count,json=droppedAttributesCount,proto3" json:"dropped_attributes_count,omitempty"`
}
diff --git a/vendor/go.opentelemetry.io/proto/otlp/resource/v1/resource.pb.go b/vendor/go.opentelemetry.io/proto/otlp/resource/v1/resource.pb.go
index bcc1060e3..b7545b03b 100644
--- a/vendor/go.opentelemetry.io/proto/otlp/resource/v1/resource.pb.go
+++ b/vendor/go.opentelemetry.io/proto/otlp/resource/v1/resource.pb.go
@@ -15,7 +15,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
// protoc-gen-go v1.26.0
-// protoc v3.17.3
+// protoc v3.21.6
// source: opentelemetry/proto/resource/v1/resource.proto
package v1
diff --git a/vendor/go.opentelemetry.io/proto/otlp/trace/v1/trace.pb.go b/vendor/go.opentelemetry.io/proto/otlp/trace/v1/trace.pb.go
index 499a43d77..51a499816 100644
--- a/vendor/go.opentelemetry.io/proto/otlp/trace/v1/trace.pb.go
+++ b/vendor/go.opentelemetry.io/proto/otlp/trace/v1/trace.pb.go
@@ -15,7 +15,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
// protoc-gen-go v1.26.0
-// protoc v3.17.3
+// protoc v3.21.6
// source: opentelemetry/proto/trace/v1/trace.proto
package v1
@@ -117,8 +117,8 @@ type Status_StatusCode int32
const (
// The default status.
Status_STATUS_CODE_UNSET Status_StatusCode = 0
- // The Span has been validated by an Application developers or Operator to have
- // completed successfully.
+ // The Span has been validated by an Application developer or Operator to
+ // have completed successfully.
Status_STATUS_CODE_OK Status_StatusCode = 1
// The Span contains an error.
Status_STATUS_CODE_ERROR Status_StatusCode = 2
@@ -374,20 +374,16 @@ type Span struct {
unknownFields protoimpl.UnknownFields
// A unique identifier for a trace. All spans from the same trace share
- // the same `trace_id`. The ID is a 16-byte array. An ID with all zeroes
- // is considered invalid.
- //
- // This field is semantically required. Receiver should generate new
- // random trace_id if empty or invalid trace_id was received.
+ // the same `trace_id`. The ID is a 16-byte array. An ID with all zeroes OR
+ // of length other than 16 bytes is considered invalid (empty string in OTLP/JSON
+ // is zero-length and thus is also invalid).
//
// This field is required.
TraceId []byte `protobuf:"bytes,1,opt,name=trace_id,json=traceId,proto3" json:"trace_id,omitempty"`
// A unique identifier for a span within a trace, assigned when the span
- // is created. The ID is an 8-byte array. An ID with all zeroes is considered
- // invalid.
- //
- // This field is semantically required. Receiver should generate new
- // random span_id if empty or invalid span_id was received.
+ // is created. The ID is an 8-byte array. An ID with all zeroes OR of length
+ // other than 8 bytes is considered invalid (empty string in OTLP/JSON
+ // is zero-length and thus is also invalid).
//
// This field is required.
SpanId []byte `protobuf:"bytes,2,opt,name=span_id,json=spanId,proto3" json:"span_id,omitempty"`
@@ -433,8 +429,8 @@ type Span struct {
//
// "/http/user_agent": "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_2) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/71.0.3578.98 Safari/537.36"
// "/http/server_latency": 300
- // "abc.com/myattribute": true
- // "abc.com/score": 10.239
+ // "example.com/myattribute": true
+ // "example.com/score": 10.239
//
// The OpenTelemetry API specification further restricts the allowed value types:
// https://github.com/open-telemetry/opentelemetry-specification/blob/main/specification/common/README.md#attribute
diff --git a/vendor/go.uber.org/atomic/.codecov.yml b/vendor/go.uber.org/atomic/.codecov.yml
deleted file mode 100644
index 571116cc3..000000000
--- a/vendor/go.uber.org/atomic/.codecov.yml
+++ /dev/null
@@ -1,19 +0,0 @@
-coverage:
- range: 80..100
- round: down
- precision: 2
-
- status:
- project: # measuring the overall project coverage
- default: # context, you can create multiple ones with custom titles
- enabled: yes # must be yes|true to enable this status
- target: 100 # specify the target coverage for each commit status
- # option: "auto" (must increase from parent commit or pull request base)
- # option: "X%" a static target percentage to hit
- if_not_found: success # if parent is not found report status as success, error, or failure
- if_ci_failed: error # if ci fails report status as success, error, or failure
-
-# Also update COVER_IGNORE_PKGS in the Makefile.
-ignore:
- - /internal/gen-atomicint/
- - /internal/gen-valuewrapper/
diff --git a/vendor/go.uber.org/atomic/.gitignore b/vendor/go.uber.org/atomic/.gitignore
deleted file mode 100644
index c3fa25389..000000000
--- a/vendor/go.uber.org/atomic/.gitignore
+++ /dev/null
@@ -1,12 +0,0 @@
-/bin
-.DS_Store
-/vendor
-cover.html
-cover.out
-lint.log
-
-# Binaries
-*.test
-
-# Profiling output
-*.prof
diff --git a/vendor/go.uber.org/atomic/.travis.yml b/vendor/go.uber.org/atomic/.travis.yml
deleted file mode 100644
index 13d0a4f25..000000000
--- a/vendor/go.uber.org/atomic/.travis.yml
+++ /dev/null
@@ -1,27 +0,0 @@
-sudo: false
-language: go
-go_import_path: go.uber.org/atomic
-
-env:
- global:
- - GO111MODULE=on
-
-matrix:
- include:
- - go: oldstable
- - go: stable
- env: LINT=1
-
-cache:
- directories:
- - vendor
-
-before_install:
- - go version
-
-script:
- - test -z "$LINT" || make lint
- - make cover
-
-after_success:
- - bash <(curl -s https://codecov.io/bash)
diff --git a/vendor/go.uber.org/atomic/CHANGELOG.md b/vendor/go.uber.org/atomic/CHANGELOG.md
deleted file mode 100644
index 24c0274dc..000000000
--- a/vendor/go.uber.org/atomic/CHANGELOG.md
+++ /dev/null
@@ -1,76 +0,0 @@
-# Changelog
-All notable changes to this project will be documented in this file.
-
-The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/),
-and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html).
-
-## [1.7.0] - 2020-09-14
-### Added
-- Support JSON serialization and deserialization of primitive atomic types.
-- Support Text marshalling and unmarshalling for string atomics.
-
-### Changed
-- Disallow incorrect comparison of atomic values in a non-atomic way.
-
-### Removed
-- Remove dependency on `golang.org/x/{lint, tools}`.
-
-## [1.6.0] - 2020-02-24
-### Changed
-- Drop library dependency on `golang.org/x/{lint, tools}`.
-
-## [1.5.1] - 2019-11-19
-- Fix bug where `Bool.CAS` and `Bool.Toggle` do work correctly together
- causing `CAS` to fail even though the old value matches.
-
-## [1.5.0] - 2019-10-29
-### Changed
-- With Go modules, only the `go.uber.org/atomic` import path is supported now.
- If you need to use the old import path, please add a `replace` directive to
- your `go.mod`.
-
-## [1.4.0] - 2019-05-01
-### Added
- - Add `atomic.Error` type for atomic operations on `error` values.
-
-## [1.3.2] - 2018-05-02
-### Added
-- Add `atomic.Duration` type for atomic operations on `time.Duration` values.
-
-## [1.3.1] - 2017-11-14
-### Fixed
-- Revert optimization for `atomic.String.Store("")` which caused data races.
-
-## [1.3.0] - 2017-11-13
-### Added
-- Add `atomic.Bool.CAS` for compare-and-swap semantics on bools.
-
-### Changed
-- Optimize `atomic.String.Store("")` by avoiding an allocation.
-
-## [1.2.0] - 2017-04-12
-### Added
-- Shadow `atomic.Value` from `sync/atomic`.
-
-## [1.1.0] - 2017-03-10
-### Added
-- Add atomic `Float64` type.
-
-### Changed
-- Support new `go.uber.org/atomic` import path.
-
-## [1.0.0] - 2016-07-18
-
-- Initial release.
-
-[1.7.0]: https://github.com/uber-go/atomic/compare/v1.6.0...v1.7.0
-[1.6.0]: https://github.com/uber-go/atomic/compare/v1.5.1...v1.6.0
-[1.5.1]: https://github.com/uber-go/atomic/compare/v1.5.0...v1.5.1
-[1.5.0]: https://github.com/uber-go/atomic/compare/v1.4.0...v1.5.0
-[1.4.0]: https://github.com/uber-go/atomic/compare/v1.3.2...v1.4.0
-[1.3.2]: https://github.com/uber-go/atomic/compare/v1.3.1...v1.3.2
-[1.3.1]: https://github.com/uber-go/atomic/compare/v1.3.0...v1.3.1
-[1.3.0]: https://github.com/uber-go/atomic/compare/v1.2.0...v1.3.0
-[1.2.0]: https://github.com/uber-go/atomic/compare/v1.1.0...v1.2.0
-[1.1.0]: https://github.com/uber-go/atomic/compare/v1.0.0...v1.1.0
-[1.0.0]: https://github.com/uber-go/atomic/releases/tag/v1.0.0
diff --git a/vendor/go.uber.org/atomic/LICENSE.txt b/vendor/go.uber.org/atomic/LICENSE.txt
deleted file mode 100644
index 8765c9fbc..000000000
--- a/vendor/go.uber.org/atomic/LICENSE.txt
+++ /dev/null
@@ -1,19 +0,0 @@
-Copyright (c) 2016 Uber Technologies, Inc.
-
-Permission is hereby granted, free of charge, to any person obtaining a copy
-of this software and associated documentation files (the "Software"), to deal
-in the Software without restriction, including without limitation the rights
-to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-copies of the Software, and to permit persons to whom the Software is
-furnished to do so, subject to the following conditions:
-
-The above copyright notice and this permission notice shall be included in
-all copies or substantial portions of the Software.
-
-THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-THE SOFTWARE.
diff --git a/vendor/go.uber.org/atomic/Makefile b/vendor/go.uber.org/atomic/Makefile
deleted file mode 100644
index 1b1376d42..000000000
--- a/vendor/go.uber.org/atomic/Makefile
+++ /dev/null
@@ -1,78 +0,0 @@
-# Directory to place `go install`ed binaries into.
-export GOBIN ?= $(shell pwd)/bin
-
-GOLINT = $(GOBIN)/golint
-GEN_ATOMICINT = $(GOBIN)/gen-atomicint
-GEN_ATOMICWRAPPER = $(GOBIN)/gen-atomicwrapper
-STATICCHECK = $(GOBIN)/staticcheck
-
-GO_FILES ?= $(shell find . '(' -path .git -o -path vendor ')' -prune -o -name '*.go' -print)
-
-# Also update ignore section in .codecov.yml.
-COVER_IGNORE_PKGS = \
- go.uber.org/atomic/internal/gen-atomicint \
- go.uber.org/atomic/internal/gen-atomicwrapper
-
-.PHONY: build
-build:
- go build ./...
-
-.PHONY: test
-test:
- go test -race ./...
-
-.PHONY: gofmt
-gofmt:
- $(eval FMT_LOG := $(shell mktemp -t gofmt.XXXXX))
- gofmt -e -s -l $(GO_FILES) > $(FMT_LOG) || true
- @[ ! -s "$(FMT_LOG)" ] || (echo "gofmt failed:" && cat $(FMT_LOG) && false)
-
-$(GOLINT):
- cd tools && go install golang.org/x/lint/golint
-
-$(STATICCHECK):
- cd tools && go install honnef.co/go/tools/cmd/staticcheck
-
-$(GEN_ATOMICWRAPPER): $(wildcard ./internal/gen-atomicwrapper/*)
- go build -o $@ ./internal/gen-atomicwrapper
-
-$(GEN_ATOMICINT): $(wildcard ./internal/gen-atomicint/*)
- go build -o $@ ./internal/gen-atomicint
-
-.PHONY: golint
-golint: $(GOLINT)
- $(GOLINT) ./...
-
-.PHONY: staticcheck
-staticcheck: $(STATICCHECK)
- $(STATICCHECK) ./...
-
-.PHONY: lint
-lint: gofmt golint staticcheck generatenodirty
-
-# comma separated list of packages to consider for code coverage.
-COVER_PKG = $(shell \
- go list -find ./... | \
- grep -v $(foreach pkg,$(COVER_IGNORE_PKGS),-e "^$(pkg)$$") | \
- paste -sd, -)
-
-.PHONY: cover
-cover:
- go test -coverprofile=cover.out -coverpkg $(COVER_PKG) -v ./...
- go tool cover -html=cover.out -o cover.html
-
-.PHONY: generate
-generate: $(GEN_ATOMICINT) $(GEN_ATOMICWRAPPER)
- go generate ./...
-
-.PHONY: generatenodirty
-generatenodirty:
- @[ -z "$$(git status --porcelain)" ] || ( \
- echo "Working tree is dirty. Commit your changes first."; \
- exit 1 )
- @make generate
- @status=$$(git status --porcelain); \
- [ -z "$$status" ] || ( \
- echo "Working tree is dirty after `make generate`:"; \
- echo "$$status"; \
- echo "Please ensure that the generated code is up-to-date." )
diff --git a/vendor/go.uber.org/atomic/README.md b/vendor/go.uber.org/atomic/README.md
deleted file mode 100644
index ade0c20f1..000000000
--- a/vendor/go.uber.org/atomic/README.md
+++ /dev/null
@@ -1,63 +0,0 @@
-# atomic [![GoDoc][doc-img]][doc] [![Build Status][ci-img]][ci] [![Coverage Status][cov-img]][cov] [![Go Report Card][reportcard-img]][reportcard]
-
-Simple wrappers for primitive types to enforce atomic access.
-
-## Installation
-
-```shell
-$ go get -u go.uber.org/atomic@v1
-```
-
-### Legacy Import Path
-
-As of v1.5.0, the import path `go.uber.org/atomic` is the only supported way
-of using this package. If you are using Go modules, this package will fail to
-compile with the legacy import path path `github.com/uber-go/atomic`.
-
-We recommend migrating your code to the new import path but if you're unable
-to do so, or if your dependencies are still using the old import path, you
-will have to add a `replace` directive to your `go.mod` file downgrading the
-legacy import path to an older version.
-
-```
-replace github.com/uber-go/atomic => github.com/uber-go/atomic v1.4.0
-```
-
-You can do so automatically by running the following command.
-
-```shell
-$ go mod edit -replace github.com/uber-go/atomic=github.com/uber-go/atomic@v1.4.0
-```
-
-## Usage
-
-The standard library's `sync/atomic` is powerful, but it's easy to forget which
-variables must be accessed atomically. `go.uber.org/atomic` preserves all the
-functionality of the standard library, but wraps the primitive types to
-provide a safer, more convenient API.
-
-```go
-var atom atomic.Uint32
-atom.Store(42)
-atom.Sub(2)
-atom.CAS(40, 11)
-```
-
-See the [documentation][doc] for a complete API specification.
-
-## Development Status
-
-Stable.
-
----
-
-Released under the [MIT License](LICENSE.txt).
-
-[doc-img]: https://godoc.org/github.com/uber-go/atomic?status.svg
-[doc]: https://godoc.org/go.uber.org/atomic
-[ci-img]: https://travis-ci.com/uber-go/atomic.svg?branch=master
-[ci]: https://travis-ci.com/uber-go/atomic
-[cov-img]: https://codecov.io/gh/uber-go/atomic/branch/master/graph/badge.svg
-[cov]: https://codecov.io/gh/uber-go/atomic
-[reportcard-img]: https://goreportcard.com/badge/go.uber.org/atomic
-[reportcard]: https://goreportcard.com/report/go.uber.org/atomic
diff --git a/vendor/go.uber.org/atomic/bool.go b/vendor/go.uber.org/atomic/bool.go
deleted file mode 100644
index 9cf1914b1..000000000
--- a/vendor/go.uber.org/atomic/bool.go
+++ /dev/null
@@ -1,81 +0,0 @@
-// @generated Code generated by gen-atomicwrapper.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
-)
-
-// Bool is an atomic type-safe wrapper for bool values.
-type Bool struct {
- _ nocmp // disallow non-atomic comparison
-
- v Uint32
-}
-
-var _zeroBool bool
-
-// NewBool creates a new Bool.
-func NewBool(v bool) *Bool {
- x := &Bool{}
- if v != _zeroBool {
- x.Store(v)
- }
- return x
-}
-
-// Load atomically loads the wrapped bool.
-func (x *Bool) Load() bool {
- return truthy(x.v.Load())
-}
-
-// Store atomically stores the passed bool.
-func (x *Bool) Store(v bool) {
- x.v.Store(boolToInt(v))
-}
-
-// CAS is an atomic compare-and-swap for bool values.
-func (x *Bool) CAS(o, n bool) bool {
- return x.v.CAS(boolToInt(o), boolToInt(n))
-}
-
-// Swap atomically stores the given bool and returns the old
-// value.
-func (x *Bool) Swap(o bool) bool {
- return truthy(x.v.Swap(boolToInt(o)))
-}
-
-// MarshalJSON encodes the wrapped bool into JSON.
-func (x *Bool) MarshalJSON() ([]byte, error) {
- return json.Marshal(x.Load())
-}
-
-// UnmarshalJSON decodes a bool from JSON.
-func (x *Bool) UnmarshalJSON(b []byte) error {
- var v bool
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- x.Store(v)
- return nil
-}
diff --git a/vendor/go.uber.org/atomic/doc.go b/vendor/go.uber.org/atomic/doc.go
deleted file mode 100644
index ae7390ee6..000000000
--- a/vendor/go.uber.org/atomic/doc.go
+++ /dev/null
@@ -1,23 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-// Package atomic provides simple wrappers around numerics to enforce atomic
-// access.
-package atomic
diff --git a/vendor/go.uber.org/atomic/duration.go b/vendor/go.uber.org/atomic/duration.go
deleted file mode 100644
index 027cfcb20..000000000
--- a/vendor/go.uber.org/atomic/duration.go
+++ /dev/null
@@ -1,82 +0,0 @@
-// @generated Code generated by gen-atomicwrapper.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
- "time"
-)
-
-// Duration is an atomic type-safe wrapper for time.Duration values.
-type Duration struct {
- _ nocmp // disallow non-atomic comparison
-
- v Int64
-}
-
-var _zeroDuration time.Duration
-
-// NewDuration creates a new Duration.
-func NewDuration(v time.Duration) *Duration {
- x := &Duration{}
- if v != _zeroDuration {
- x.Store(v)
- }
- return x
-}
-
-// Load atomically loads the wrapped time.Duration.
-func (x *Duration) Load() time.Duration {
- return time.Duration(x.v.Load())
-}
-
-// Store atomically stores the passed time.Duration.
-func (x *Duration) Store(v time.Duration) {
- x.v.Store(int64(v))
-}
-
-// CAS is an atomic compare-and-swap for time.Duration values.
-func (x *Duration) CAS(o, n time.Duration) bool {
- return x.v.CAS(int64(o), int64(n))
-}
-
-// Swap atomically stores the given time.Duration and returns the old
-// value.
-func (x *Duration) Swap(o time.Duration) time.Duration {
- return time.Duration(x.v.Swap(int64(o)))
-}
-
-// MarshalJSON encodes the wrapped time.Duration into JSON.
-func (x *Duration) MarshalJSON() ([]byte, error) {
- return json.Marshal(x.Load())
-}
-
-// UnmarshalJSON decodes a time.Duration from JSON.
-func (x *Duration) UnmarshalJSON(b []byte) error {
- var v time.Duration
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- x.Store(v)
- return nil
-}
diff --git a/vendor/go.uber.org/atomic/duration_ext.go b/vendor/go.uber.org/atomic/duration_ext.go
deleted file mode 100644
index 6273b66bd..000000000
--- a/vendor/go.uber.org/atomic/duration_ext.go
+++ /dev/null
@@ -1,40 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import "time"
-
-//go:generate bin/gen-atomicwrapper -name=Duration -type=time.Duration -wrapped=Int64 -pack=int64 -unpack=time.Duration -cas -swap -json -imports time -file=duration.go
-
-// Add atomically adds to the wrapped time.Duration and returns the new value.
-func (d *Duration) Add(n time.Duration) time.Duration {
- return time.Duration(d.v.Add(int64(n)))
-}
-
-// Sub atomically subtracts from the wrapped time.Duration and returns the new value.
-func (d *Duration) Sub(n time.Duration) time.Duration {
- return time.Duration(d.v.Sub(int64(n)))
-}
-
-// String encodes the wrapped value as a string.
-func (d *Duration) String() string {
- return d.Load().String()
-}
diff --git a/vendor/go.uber.org/atomic/error.go b/vendor/go.uber.org/atomic/error.go
deleted file mode 100644
index a6166fbea..000000000
--- a/vendor/go.uber.org/atomic/error.go
+++ /dev/null
@@ -1,51 +0,0 @@
-// @generated Code generated by gen-atomicwrapper.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-// Error is an atomic type-safe wrapper for error values.
-type Error struct {
- _ nocmp // disallow non-atomic comparison
-
- v Value
-}
-
-var _zeroError error
-
-// NewError creates a new Error.
-func NewError(v error) *Error {
- x := &Error{}
- if v != _zeroError {
- x.Store(v)
- }
- return x
-}
-
-// Load atomically loads the wrapped error.
-func (x *Error) Load() error {
- return unpackError(x.v.Load())
-}
-
-// Store atomically stores the passed error.
-func (x *Error) Store(v error) {
- x.v.Store(packError(v))
-}
diff --git a/vendor/go.uber.org/atomic/float64.go b/vendor/go.uber.org/atomic/float64.go
deleted file mode 100644
index 071906020..000000000
--- a/vendor/go.uber.org/atomic/float64.go
+++ /dev/null
@@ -1,76 +0,0 @@
-// @generated Code generated by gen-atomicwrapper.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
- "math"
-)
-
-// Float64 is an atomic type-safe wrapper for float64 values.
-type Float64 struct {
- _ nocmp // disallow non-atomic comparison
-
- v Uint64
-}
-
-var _zeroFloat64 float64
-
-// NewFloat64 creates a new Float64.
-func NewFloat64(v float64) *Float64 {
- x := &Float64{}
- if v != _zeroFloat64 {
- x.Store(v)
- }
- return x
-}
-
-// Load atomically loads the wrapped float64.
-func (x *Float64) Load() float64 {
- return math.Float64frombits(x.v.Load())
-}
-
-// Store atomically stores the passed float64.
-func (x *Float64) Store(v float64) {
- x.v.Store(math.Float64bits(v))
-}
-
-// CAS is an atomic compare-and-swap for float64 values.
-func (x *Float64) CAS(o, n float64) bool {
- return x.v.CAS(math.Float64bits(o), math.Float64bits(n))
-}
-
-// MarshalJSON encodes the wrapped float64 into JSON.
-func (x *Float64) MarshalJSON() ([]byte, error) {
- return json.Marshal(x.Load())
-}
-
-// UnmarshalJSON decodes a float64 from JSON.
-func (x *Float64) UnmarshalJSON(b []byte) error {
- var v float64
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- x.Store(v)
- return nil
-}
diff --git a/vendor/go.uber.org/atomic/float64_ext.go b/vendor/go.uber.org/atomic/float64_ext.go
deleted file mode 100644
index 927b1add7..000000000
--- a/vendor/go.uber.org/atomic/float64_ext.go
+++ /dev/null
@@ -1,47 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import "strconv"
-
-//go:generate bin/gen-atomicwrapper -name=Float64 -type=float64 -wrapped=Uint64 -pack=math.Float64bits -unpack=math.Float64frombits -cas -json -imports math -file=float64.go
-
-// Add atomically adds to the wrapped float64 and returns the new value.
-func (f *Float64) Add(s float64) float64 {
- for {
- old := f.Load()
- new := old + s
- if f.CAS(old, new) {
- return new
- }
- }
-}
-
-// Sub atomically subtracts from the wrapped float64 and returns the new value.
-func (f *Float64) Sub(s float64) float64 {
- return f.Add(-s)
-}
-
-// String encodes the wrapped value as a string.
-func (f *Float64) String() string {
- // 'g' is the behavior for floats with %v.
- return strconv.FormatFloat(f.Load(), 'g', -1, 64)
-}
diff --git a/vendor/go.uber.org/atomic/gen.go b/vendor/go.uber.org/atomic/gen.go
deleted file mode 100644
index 50d6b2485..000000000
--- a/vendor/go.uber.org/atomic/gen.go
+++ /dev/null
@@ -1,26 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-//go:generate bin/gen-atomicint -name=Int32 -wrapped=int32 -file=int32.go
-//go:generate bin/gen-atomicint -name=Int64 -wrapped=int64 -file=int64.go
-//go:generate bin/gen-atomicint -name=Uint32 -wrapped=uint32 -unsigned -file=uint32.go
-//go:generate bin/gen-atomicint -name=Uint64 -wrapped=uint64 -unsigned -file=uint64.go
diff --git a/vendor/go.uber.org/atomic/int32.go b/vendor/go.uber.org/atomic/int32.go
deleted file mode 100644
index 18ae56493..000000000
--- a/vendor/go.uber.org/atomic/int32.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// @generated Code generated by gen-atomicint.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
- "strconv"
- "sync/atomic"
-)
-
-// Int32 is an atomic wrapper around int32.
-type Int32 struct {
- _ nocmp // disallow non-atomic comparison
-
- v int32
-}
-
-// NewInt32 creates a new Int32.
-func NewInt32(i int32) *Int32 {
- return &Int32{v: i}
-}
-
-// Load atomically loads the wrapped value.
-func (i *Int32) Load() int32 {
- return atomic.LoadInt32(&i.v)
-}
-
-// Add atomically adds to the wrapped int32 and returns the new value.
-func (i *Int32) Add(n int32) int32 {
- return atomic.AddInt32(&i.v, n)
-}
-
-// Sub atomically subtracts from the wrapped int32 and returns the new value.
-func (i *Int32) Sub(n int32) int32 {
- return atomic.AddInt32(&i.v, -n)
-}
-
-// Inc atomically increments the wrapped int32 and returns the new value.
-func (i *Int32) Inc() int32 {
- return i.Add(1)
-}
-
-// Dec atomically decrements the wrapped int32 and returns the new value.
-func (i *Int32) Dec() int32 {
- return i.Sub(1)
-}
-
-// CAS is an atomic compare-and-swap.
-func (i *Int32) CAS(old, new int32) bool {
- return atomic.CompareAndSwapInt32(&i.v, old, new)
-}
-
-// Store atomically stores the passed value.
-func (i *Int32) Store(n int32) {
- atomic.StoreInt32(&i.v, n)
-}
-
-// Swap atomically swaps the wrapped int32 and returns the old value.
-func (i *Int32) Swap(n int32) int32 {
- return atomic.SwapInt32(&i.v, n)
-}
-
-// MarshalJSON encodes the wrapped int32 into JSON.
-func (i *Int32) MarshalJSON() ([]byte, error) {
- return json.Marshal(i.Load())
-}
-
-// UnmarshalJSON decodes JSON into the wrapped int32.
-func (i *Int32) UnmarshalJSON(b []byte) error {
- var v int32
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- i.Store(v)
- return nil
-}
-
-// String encodes the wrapped value as a string.
-func (i *Int32) String() string {
- v := i.Load()
- return strconv.FormatInt(int64(v), 10)
-}
diff --git a/vendor/go.uber.org/atomic/int64.go b/vendor/go.uber.org/atomic/int64.go
deleted file mode 100644
index 2bcbbfaa9..000000000
--- a/vendor/go.uber.org/atomic/int64.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// @generated Code generated by gen-atomicint.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
- "strconv"
- "sync/atomic"
-)
-
-// Int64 is an atomic wrapper around int64.
-type Int64 struct {
- _ nocmp // disallow non-atomic comparison
-
- v int64
-}
-
-// NewInt64 creates a new Int64.
-func NewInt64(i int64) *Int64 {
- return &Int64{v: i}
-}
-
-// Load atomically loads the wrapped value.
-func (i *Int64) Load() int64 {
- return atomic.LoadInt64(&i.v)
-}
-
-// Add atomically adds to the wrapped int64 and returns the new value.
-func (i *Int64) Add(n int64) int64 {
- return atomic.AddInt64(&i.v, n)
-}
-
-// Sub atomically subtracts from the wrapped int64 and returns the new value.
-func (i *Int64) Sub(n int64) int64 {
- return atomic.AddInt64(&i.v, -n)
-}
-
-// Inc atomically increments the wrapped int64 and returns the new value.
-func (i *Int64) Inc() int64 {
- return i.Add(1)
-}
-
-// Dec atomically decrements the wrapped int64 and returns the new value.
-func (i *Int64) Dec() int64 {
- return i.Sub(1)
-}
-
-// CAS is an atomic compare-and-swap.
-func (i *Int64) CAS(old, new int64) bool {
- return atomic.CompareAndSwapInt64(&i.v, old, new)
-}
-
-// Store atomically stores the passed value.
-func (i *Int64) Store(n int64) {
- atomic.StoreInt64(&i.v, n)
-}
-
-// Swap atomically swaps the wrapped int64 and returns the old value.
-func (i *Int64) Swap(n int64) int64 {
- return atomic.SwapInt64(&i.v, n)
-}
-
-// MarshalJSON encodes the wrapped int64 into JSON.
-func (i *Int64) MarshalJSON() ([]byte, error) {
- return json.Marshal(i.Load())
-}
-
-// UnmarshalJSON decodes JSON into the wrapped int64.
-func (i *Int64) UnmarshalJSON(b []byte) error {
- var v int64
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- i.Store(v)
- return nil
-}
-
-// String encodes the wrapped value as a string.
-func (i *Int64) String() string {
- v := i.Load()
- return strconv.FormatInt(int64(v), 10)
-}
diff --git a/vendor/go.uber.org/atomic/nocmp.go b/vendor/go.uber.org/atomic/nocmp.go
deleted file mode 100644
index a8201cb4a..000000000
--- a/vendor/go.uber.org/atomic/nocmp.go
+++ /dev/null
@@ -1,35 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-// nocmp is an uncomparable struct. Embed this inside another struct to make
-// it uncomparable.
-//
-// type Foo struct {
-// nocmp
-// // ...
-// }
-//
-// This DOES NOT:
-//
-// - Disallow shallow copies of structs
-// - Disallow comparison of pointers to uncomparable structs
-type nocmp [0]func()
diff --git a/vendor/go.uber.org/atomic/string_ext.go b/vendor/go.uber.org/atomic/string_ext.go
deleted file mode 100644
index 3a9558213..000000000
--- a/vendor/go.uber.org/atomic/string_ext.go
+++ /dev/null
@@ -1,43 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-//go:generate bin/gen-atomicwrapper -name=String -type=string -wrapped=Value -file=string.go
-
-// String returns the wrapped value.
-func (s *String) String() string {
- return s.Load()
-}
-
-// MarshalText encodes the wrapped string into a textual form.
-//
-// This makes it encodable as JSON, YAML, XML, and more.
-func (s *String) MarshalText() ([]byte, error) {
- return []byte(s.Load()), nil
-}
-
-// UnmarshalText decodes text and replaces the wrapped string with it.
-//
-// This makes it decodable from JSON, YAML, XML, and more.
-func (s *String) UnmarshalText(b []byte) error {
- s.Store(string(b))
- return nil
-}
diff --git a/vendor/go.uber.org/atomic/uint32.go b/vendor/go.uber.org/atomic/uint32.go
deleted file mode 100644
index a973aba1a..000000000
--- a/vendor/go.uber.org/atomic/uint32.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// @generated Code generated by gen-atomicint.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
- "strconv"
- "sync/atomic"
-)
-
-// Uint32 is an atomic wrapper around uint32.
-type Uint32 struct {
- _ nocmp // disallow non-atomic comparison
-
- v uint32
-}
-
-// NewUint32 creates a new Uint32.
-func NewUint32(i uint32) *Uint32 {
- return &Uint32{v: i}
-}
-
-// Load atomically loads the wrapped value.
-func (i *Uint32) Load() uint32 {
- return atomic.LoadUint32(&i.v)
-}
-
-// Add atomically adds to the wrapped uint32 and returns the new value.
-func (i *Uint32) Add(n uint32) uint32 {
- return atomic.AddUint32(&i.v, n)
-}
-
-// Sub atomically subtracts from the wrapped uint32 and returns the new value.
-func (i *Uint32) Sub(n uint32) uint32 {
- return atomic.AddUint32(&i.v, ^(n - 1))
-}
-
-// Inc atomically increments the wrapped uint32 and returns the new value.
-func (i *Uint32) Inc() uint32 {
- return i.Add(1)
-}
-
-// Dec atomically decrements the wrapped uint32 and returns the new value.
-func (i *Uint32) Dec() uint32 {
- return i.Sub(1)
-}
-
-// CAS is an atomic compare-and-swap.
-func (i *Uint32) CAS(old, new uint32) bool {
- return atomic.CompareAndSwapUint32(&i.v, old, new)
-}
-
-// Store atomically stores the passed value.
-func (i *Uint32) Store(n uint32) {
- atomic.StoreUint32(&i.v, n)
-}
-
-// Swap atomically swaps the wrapped uint32 and returns the old value.
-func (i *Uint32) Swap(n uint32) uint32 {
- return atomic.SwapUint32(&i.v, n)
-}
-
-// MarshalJSON encodes the wrapped uint32 into JSON.
-func (i *Uint32) MarshalJSON() ([]byte, error) {
- return json.Marshal(i.Load())
-}
-
-// UnmarshalJSON decodes JSON into the wrapped uint32.
-func (i *Uint32) UnmarshalJSON(b []byte) error {
- var v uint32
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- i.Store(v)
- return nil
-}
-
-// String encodes the wrapped value as a string.
-func (i *Uint32) String() string {
- v := i.Load()
- return strconv.FormatUint(uint64(v), 10)
-}
diff --git a/vendor/go.uber.org/atomic/uint64.go b/vendor/go.uber.org/atomic/uint64.go
deleted file mode 100644
index 3b6c71fd5..000000000
--- a/vendor/go.uber.org/atomic/uint64.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// @generated Code generated by gen-atomicint.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import (
- "encoding/json"
- "strconv"
- "sync/atomic"
-)
-
-// Uint64 is an atomic wrapper around uint64.
-type Uint64 struct {
- _ nocmp // disallow non-atomic comparison
-
- v uint64
-}
-
-// NewUint64 creates a new Uint64.
-func NewUint64(i uint64) *Uint64 {
- return &Uint64{v: i}
-}
-
-// Load atomically loads the wrapped value.
-func (i *Uint64) Load() uint64 {
- return atomic.LoadUint64(&i.v)
-}
-
-// Add atomically adds to the wrapped uint64 and returns the new value.
-func (i *Uint64) Add(n uint64) uint64 {
- return atomic.AddUint64(&i.v, n)
-}
-
-// Sub atomically subtracts from the wrapped uint64 and returns the new value.
-func (i *Uint64) Sub(n uint64) uint64 {
- return atomic.AddUint64(&i.v, ^(n - 1))
-}
-
-// Inc atomically increments the wrapped uint64 and returns the new value.
-func (i *Uint64) Inc() uint64 {
- return i.Add(1)
-}
-
-// Dec atomically decrements the wrapped uint64 and returns the new value.
-func (i *Uint64) Dec() uint64 {
- return i.Sub(1)
-}
-
-// CAS is an atomic compare-and-swap.
-func (i *Uint64) CAS(old, new uint64) bool {
- return atomic.CompareAndSwapUint64(&i.v, old, new)
-}
-
-// Store atomically stores the passed value.
-func (i *Uint64) Store(n uint64) {
- atomic.StoreUint64(&i.v, n)
-}
-
-// Swap atomically swaps the wrapped uint64 and returns the old value.
-func (i *Uint64) Swap(n uint64) uint64 {
- return atomic.SwapUint64(&i.v, n)
-}
-
-// MarshalJSON encodes the wrapped uint64 into JSON.
-func (i *Uint64) MarshalJSON() ([]byte, error) {
- return json.Marshal(i.Load())
-}
-
-// UnmarshalJSON decodes JSON into the wrapped uint64.
-func (i *Uint64) UnmarshalJSON(b []byte) error {
- var v uint64
- if err := json.Unmarshal(b, &v); err != nil {
- return err
- }
- i.Store(v)
- return nil
-}
-
-// String encodes the wrapped value as a string.
-func (i *Uint64) String() string {
- v := i.Load()
- return strconv.FormatUint(uint64(v), 10)
-}
diff --git a/vendor/go.uber.org/atomic/value.go b/vendor/go.uber.org/atomic/value.go
deleted file mode 100644
index 671f3a382..000000000
--- a/vendor/go.uber.org/atomic/value.go
+++ /dev/null
@@ -1,31 +0,0 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-package atomic
-
-import "sync/atomic"
-
-// Value shadows the type of the same name from sync/atomic
-// https://godoc.org/sync/atomic#Value
-type Value struct {
- atomic.Value
-
- _ nocmp // disallow non-atomic comparison
-}
diff --git a/vendor/go.uber.org/multierr/.travis.yml b/vendor/go.uber.org/multierr/.travis.yml
deleted file mode 100644
index 8636ab42a..000000000
--- a/vendor/go.uber.org/multierr/.travis.yml
+++ /dev/null
@@ -1,23 +0,0 @@
-sudo: false
-language: go
-go_import_path: go.uber.org/multierr
-
-env:
- global:
- - GO111MODULE=on
-
-go:
- - oldstable
- - stable
-
-before_install:
-- go version
-
-script:
-- |
- set -e
- make lint
- make cover
-
-after_success:
-- bash <(curl -s https://codecov.io/bash)
diff --git a/vendor/go.uber.org/multierr/CHANGELOG.md b/vendor/go.uber.org/multierr/CHANGELOG.md
index 6f1db9ef4..f8177b978 100644
--- a/vendor/go.uber.org/multierr/CHANGELOG.md
+++ b/vendor/go.uber.org/multierr/CHANGELOG.md
@@ -1,6 +1,41 @@
Releases
========
+v1.11.0 (2023-03-28)
+====================
+- `Errors` now supports any error that implements multiple-error
+ interface.
+- Add `Every` function to allow checking if all errors in the chain
+ satisfies `errors.Is` against the target error.
+
+v1.10.0 (2023-03-08)
+====================
+
+- Comply with Go 1.20's multiple-error interface.
+- Drop Go 1.18 support.
+ Per the support policy, only Go 1.19 and 1.20 are supported now.
+- Drop all non-test external dependencies.
+
+v1.9.0 (2022-12-12)
+===================
+
+- Add `AppendFunc` that allow passsing functions to similar to
+ `AppendInvoke`.
+
+- Bump up yaml.v3 dependency to 3.0.1.
+
+v1.8.0 (2022-02-28)
+===================
+
+- `Combine`: perform zero allocations when there are no errors.
+
+
+v1.7.0 (2021-05-06)
+===================
+
+- Add `AppendInvoke` to append into errors from `defer` blocks.
+
+
v1.6.0 (2020-09-14)
===================
diff --git a/vendor/go.uber.org/multierr/LICENSE.txt b/vendor/go.uber.org/multierr/LICENSE.txt
index 858e02475..413e30f7c 100644
--- a/vendor/go.uber.org/multierr/LICENSE.txt
+++ b/vendor/go.uber.org/multierr/LICENSE.txt
@@ -1,4 +1,4 @@
-Copyright (c) 2017 Uber Technologies, Inc.
+Copyright (c) 2017-2021 Uber Technologies, Inc.
Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
diff --git a/vendor/go.uber.org/multierr/Makefile b/vendor/go.uber.org/multierr/Makefile
index 316004400..dcb6fe723 100644
--- a/vendor/go.uber.org/multierr/Makefile
+++ b/vendor/go.uber.org/multierr/Makefile
@@ -34,9 +34,5 @@ lint: gofmt golint staticcheck
.PHONY: cover
cover:
- go test -coverprofile=cover.out -coverpkg=./... -v ./...
+ go test -race -coverprofile=cover.out -coverpkg=./... -v ./...
go tool cover -html=cover.out -o cover.html
-
-update-license:
- @cd tools && go install go.uber.org/tools/update-license
- @$(GOBIN)/update-license $(GO_FILES)
diff --git a/vendor/go.uber.org/multierr/README.md b/vendor/go.uber.org/multierr/README.md
index 751bd65e5..5ab6ac40f 100644
--- a/vendor/go.uber.org/multierr/README.md
+++ b/vendor/go.uber.org/multierr/README.md
@@ -2,9 +2,29 @@
`multierr` allows combining one or more Go `error`s together.
+## Features
+
+- **Idiomatic**:
+ multierr follows best practices in Go, and keeps your code idiomatic.
+ - It keeps the underlying error type hidden,
+ allowing you to deal in `error` values exclusively.
+ - It provides APIs to safely append into an error from a `defer` statement.
+- **Performant**:
+ multierr is optimized for performance:
+ - It avoids allocations where possible.
+ - It utilizes slice resizing semantics to optimize common cases
+ like appending into the same error object from a loop.
+- **Interoperable**:
+ multierr interoperates with the Go standard library's error APIs seamlessly:
+ - The `errors.Is` and `errors.As` functions *just work*.
+- **Lightweight**:
+ multierr comes with virtually no dependencies.
+
## Installation
- go get -u go.uber.org/multierr
+```bash
+go get -u go.uber.org/multierr@latest
+```
## Status
@@ -15,9 +35,9 @@ Stable: No breaking changes will be made before 2.0.
Released under the [MIT License].
[MIT License]: LICENSE.txt
-[doc-img]: https://godoc.org/go.uber.org/multierr?status.svg
-[doc]: https://godoc.org/go.uber.org/multierr
-[ci-img]: https://travis-ci.com/uber-go/multierr.svg?branch=master
+[doc-img]: https://pkg.go.dev/badge/go.uber.org/multierr
+[doc]: https://pkg.go.dev/go.uber.org/multierr
+[ci-img]: https://github.com/uber-go/multierr/actions/workflows/go.yml/badge.svg
[cov-img]: https://codecov.io/gh/uber-go/multierr/branch/master/graph/badge.svg
-[ci]: https://travis-ci.com/uber-go/multierr
+[ci]: https://github.com/uber-go/multierr/actions/workflows/go.yml
[cov]: https://codecov.io/gh/uber-go/multierr
diff --git a/vendor/go.uber.org/multierr/error.go b/vendor/go.uber.org/multierr/error.go
index 5c9b67d53..3a828b2df 100644
--- a/vendor/go.uber.org/multierr/error.go
+++ b/vendor/go.uber.org/multierr/error.go
@@ -1,4 +1,4 @@
-// Copyright (c) 2019 Uber Technologies, Inc.
+// Copyright (c) 2017-2023 Uber Technologies, Inc.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
@@ -20,54 +20,109 @@
// Package multierr allows combining one or more errors together.
//
-// Overview
+// # Overview
//
// Errors can be combined with the use of the Combine function.
//
-// multierr.Combine(
-// reader.Close(),
-// writer.Close(),
-// conn.Close(),
-// )
+// multierr.Combine(
+// reader.Close(),
+// writer.Close(),
+// conn.Close(),
+// )
//
// If only two errors are being combined, the Append function may be used
// instead.
//
-// err = multierr.Append(reader.Close(), writer.Close())
-//
-// This makes it possible to record resource cleanup failures from deferred
-// blocks with the help of named return values.
-//
-// func sendRequest(req Request) (err error) {
-// conn, err := openConnection()
-// if err != nil {
-// return err
-// }
-// defer func() {
-// err = multierr.Append(err, conn.Close())
-// }()
-// // ...
-// }
+// err = multierr.Append(reader.Close(), writer.Close())
//
// The underlying list of errors for a returned error object may be retrieved
// with the Errors function.
//
-// errors := multierr.Errors(err)
-// if len(errors) > 0 {
-// fmt.Println("The following errors occurred:", errors)
-// }
+// errors := multierr.Errors(err)
+// if len(errors) > 0 {
+// fmt.Println("The following errors occurred:", errors)
+// }
+//
+// # Appending from a loop
+//
+// You sometimes need to append into an error from a loop.
+//
+// var err error
+// for _, item := range items {
+// err = multierr.Append(err, process(item))
+// }
+//
+// Cases like this may require knowledge of whether an individual instance
+// failed. This usually requires introduction of a new variable.
+//
+// var err error
+// for _, item := range items {
+// if perr := process(item); perr != nil {
+// log.Warn("skipping item", item)
+// err = multierr.Append(err, perr)
+// }
+// }
+//
+// multierr includes AppendInto to simplify cases like this.
+//
+// var err error
+// for _, item := range items {
+// if multierr.AppendInto(&err, process(item)) {
+// log.Warn("skipping item", item)
+// }
+// }
+//
+// This will append the error into the err variable, and return true if that
+// individual error was non-nil.
//
-// Advanced Usage
+// See [AppendInto] for more information.
+//
+// # Deferred Functions
+//
+// Go makes it possible to modify the return value of a function in a defer
+// block if the function was using named returns. This makes it possible to
+// record resource cleanup failures from deferred blocks.
+//
+// func sendRequest(req Request) (err error) {
+// conn, err := openConnection()
+// if err != nil {
+// return err
+// }
+// defer func() {
+// err = multierr.Append(err, conn.Close())
+// }()
+// // ...
+// }
+//
+// multierr provides the Invoker type and AppendInvoke function to make cases
+// like the above simpler and obviate the need for a closure. The following is
+// roughly equivalent to the example above.
+//
+// func sendRequest(req Request) (err error) {
+// conn, err := openConnection()
+// if err != nil {
+// return err
+// }
+// defer multierr.AppendInvoke(&err, multierr.Close(conn))
+// // ...
+// }
+//
+// See [AppendInvoke] and [Invoker] for more information.
+//
+// NOTE: If you're modifying an error from inside a defer, you MUST use a named
+// return value for that function.
+//
+// # Advanced Usage
//
// Errors returned by Combine and Append MAY implement the following
// interface.
//
-// type errorGroup interface {
-// // Returns a slice containing the underlying list of errors.
-// //
-// // This slice MUST NOT be modified by the caller.
-// Errors() []error
-// }
+// type errorGroup interface {
+// // Returns a slice containing the underlying list of errors.
+// //
+// // This slice MUST NOT be modified by the caller.
+// Errors() []error
+// }
//
// Note that if you need access to list of errors behind a multierr error, you
// should prefer using the Errors function. That said, if you need cheap
@@ -76,23 +131,23 @@
// because errors returned by Combine and Append are not guaranteed to
// implement this interface.
//
-// var errors []error
-// group, ok := err.(errorGroup)
-// if ok {
-// errors = group.Errors()
-// } else {
-// errors = []error{err}
-// }
+// var errors []error
+// group, ok := err.(errorGroup)
+// if ok {
+// errors = group.Errors()
+// } else {
+// errors = []error{err}
+// }
package multierr // import "go.uber.org/multierr"
import (
"bytes"
+ "errors"
"fmt"
"io"
"strings"
"sync"
-
- "go.uber.org/atomic"
+ "sync/atomic"
)
var (
@@ -132,34 +187,15 @@ type errorGroup interface {
// Errors returns a slice containing zero or more errors that the supplied
// error is composed of. If the error is nil, a nil slice is returned.
//
-// err := multierr.Append(r.Close(), w.Close())
-// errors := multierr.Errors(err)
+// err := multierr.Append(r.Close(), w.Close())
+// errors := multierr.Errors(err)
//
// If the error is not composed of other errors, the returned slice contains
// just the error that was passed in.
//
// Callers of this function are free to modify the returned slice.
func Errors(err error) []error {
- if err == nil {
- return nil
- }
-
- // Note that we're casting to multiError, not errorGroup. Our contract is
- // that returned errors MAY implement errorGroup. Errors, however, only
- // has special behavior for multierr-specific error objects.
- //
- // This behavior can be expanded in the future but I think it's prudent to
- // start with as little as possible in terms of contract and possibility
- // of misuse.
- eg, ok := err.(*multiError)
- if !ok {
- return []error{err}
- }
-
- errors := eg.Errors()
- result := make([]error, len(errors))
- copy(result, errors)
- return result
+ return extractErrors(err)
}
// multiError is an error that holds one or more errors.
@@ -174,8 +210,6 @@ type multiError struct {
errors []error
}
-var _ errorGroup = (*multiError)(nil)
-
// Errors returns the list of underlying errors.
//
// This slice MUST NOT be modified.
@@ -201,6 +235,17 @@ func (merr *multiError) Error() string {
return result
}
+// Every compares every error in the given err against the given target error
+// using [errors.Is], and returns true only if every comparison returned true.
+func Every(err error, target error) bool {
+ for _, e := range extractErrors(err) {
+ if !errors.Is(e, target) {
+ return false
+ }
+ }
+ return true
+}
+
func (merr *multiError) Format(f fmt.State, c rune) {
if c == 'v' && f.Flag('+') {
merr.writeMultiline(f)
@@ -292,6 +337,14 @@ func inspect(errors []error) (res inspectResult) {
// fromSlice converts the given list of errors into a single error.
func fromSlice(errors []error) error {
+ // Don't pay to inspect small slices.
+ switch len(errors) {
+ case 0:
+ return nil
+ case 1:
+ return errors[0]
+ }
+
res := inspect(errors)
switch res.Count {
case 0:
@@ -301,8 +354,12 @@ func fromSlice(errors []error) error {
return errors[res.FirstErrorIdx]
case len(errors):
if !res.ContainsMultiError {
- // already flat
- return &multiError{errors: errors}
+ // Error list is flat. Make a copy of it
+ // Otherwise "errors" escapes to the heap
+ // unconditionally for all other cases.
+ // This lets us optimize for the "no errors" case.
+ out := append(([]error)(nil), errors...)
+ return &multiError{errors: out}
}
}
@@ -327,32 +384,32 @@ func fromSlice(errors []error) error {
// If zero arguments were passed or if all items are nil, a nil error is
// returned.
//
-// Combine(nil, nil) // == nil
+// Combine(nil, nil) // == nil
//
// If only a single error was passed, it is returned as-is.
//
-// Combine(err) // == err
+// Combine(err) // == err
//
// Combine skips over nil arguments so this function may be used to combine
// together errors from operations that fail independently of each other.
//
-// multierr.Combine(
-// reader.Close(),
-// writer.Close(),
-// pipe.Close(),
-// )
+// multierr.Combine(
+// reader.Close(),
+// writer.Close(),
+// pipe.Close(),
+// )
//
// If any of the passed errors is a multierr error, it will be flattened along
// with the other errors.
//
-// multierr.Combine(multierr.Combine(err1, err2), err3)
-// // is the same as
-// multierr.Combine(err1, err2, err3)
+// multierr.Combine(multierr.Combine(err1, err2), err3)
+// // is the same as
+// multierr.Combine(err1, err2, err3)
//
// The returned error formats into a readable multi-line error message if
// formatted with %+v.
//
-// fmt.Sprintf("%+v", multierr.Combine(err1, err2))
+// fmt.Sprintf("%+v", multierr.Combine(err1, err2))
func Combine(errors ...error) error {
return fromSlice(errors)
}
@@ -362,16 +419,19 @@ func Combine(errors ...error) error {
// This function is a specialization of Combine for the common case where
// there are only two errors.
//
-// err = multierr.Append(reader.Close(), writer.Close())
+// err = multierr.Append(reader.Close(), writer.Close())
//
// The following pattern may also be used to record failure of deferred
// operations without losing information about the original error.
//
-// func doSomething(..) (err error) {
-// f := acquireResource()
-// defer func() {
-// err = multierr.Append(err, f.Close())
-// }()
+// func doSomething(..) (err error) {
+// f := acquireResource()
+// defer func() {
+// err = multierr.Append(err, f.Close())
+// }()
+//
+// Note that the variable MUST be a named return to append an error to it from
+// the defer statement. See also [AppendInvoke].
func Append(left error, right error) error {
switch {
case left == nil:
@@ -401,37 +461,37 @@ func Append(left error, right error) error {
// AppendInto appends an error into the destination of an error pointer and
// returns whether the error being appended was non-nil.
//
-// var err error
-// multierr.AppendInto(&err, r.Close())
-// multierr.AppendInto(&err, w.Close())
+// var err error
+// multierr.AppendInto(&err, r.Close())
+// multierr.AppendInto(&err, w.Close())
//
// The above is equivalent to,
//
-// err := multierr.Append(r.Close(), w.Close())
+// err := multierr.Append(r.Close(), w.Close())
//
// As AppendInto reports whether the provided error was non-nil, it may be
// used to build a multierr error in a loop more ergonomically. For example:
//
-// var err error
-// for line := range lines {
-// var item Item
-// if multierr.AppendInto(&err, parse(line, &item)) {
-// continue
-// }
-// items = append(items, item)
-// }
-//
-// Compare this with a verison that relies solely on Append:
-//
-// var err error
-// for line := range lines {
-// var item Item
-// if parseErr := parse(line, &item); parseErr != nil {
-// err = multierr.Append(err, parseErr)
-// continue
-// }
-// items = append(items, item)
-// }
+// var err error
+// for line := range lines {
+// var item Item
+// if multierr.AppendInto(&err, parse(line, &item)) {
+// continue
+// }
+// items = append(items, item)
+// }
+//
+// Compare this with a version that relies solely on Append:
+//
+// var err error
+// for line := range lines {
+// var item Item
+// if parseErr := parse(line, &item); parseErr != nil {
+// err = multierr.Append(err, parseErr)
+// continue
+// }
+// items = append(items, item)
+// }
func AppendInto(into *error, err error) (errored bool) {
if into == nil {
// We panic if 'into' is nil. This is not documented above
@@ -447,3 +507,140 @@ func AppendInto(into *error, err error) (errored bool) {
*into = Append(*into, err)
return true
}
+
+// Invoker is an operation that may fail with an error. Use it with
+// AppendInvoke to append the result of calling the function into an error.
+// This allows you to conveniently defer capture of failing operations.
+//
+// See also, [Close] and [Invoke].
+type Invoker interface {
+ Invoke() error
+}
+
+// Invoke wraps a function which may fail with an error to match the Invoker
+// interface. Use it to supply functions matching this signature to
+// AppendInvoke.
+//
+// For example,
+//
+// func processReader(r io.Reader) (err error) {
+// scanner := bufio.NewScanner(r)
+// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err))
+// for scanner.Scan() {
+// // ...
+// }
+// // ...
+// }
+//
+// In this example, the following line will construct the Invoker right away,
+// but defer the invocation of scanner.Err() until the function returns.
+//
+// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err))
+//
+// Note that the error you're appending to from the defer statement MUST be a
+// named return.
+type Invoke func() error
+
+// Invoke calls the supplied function and returns its result.
+func (i Invoke) Invoke() error { return i() }
+
+// Close builds an Invoker that closes the provided io.Closer. Use it with
+// AppendInvoke to close io.Closers and append their results into an error.
+//
+// For example,
+//
+// func processFile(path string) (err error) {
+// f, err := os.Open(path)
+// if err != nil {
+// return err
+// }
+// defer multierr.AppendInvoke(&err, multierr.Close(f))
+// return processReader(f)
+// }
+//
+// In this example, multierr.Close will construct the Invoker right away, but
+// defer the invocation of f.Close until the function returns.
+//
+// defer multierr.AppendInvoke(&err, multierr.Close(f))
+//
+// Note that the error you're appending to from the defer statement MUST be a
+// named return.
+func Close(closer io.Closer) Invoker {
+ return Invoke(closer.Close)
+}
+
+// AppendInvoke appends the result of calling the given Invoker into the
+// provided error pointer. Use it with named returns to safely defer
+// invocation of fallible operations until a function returns, and capture the
+// resulting errors.
+//
+// func doSomething(...) (err error) {
+// // ...
+// f, err := openFile(..)
+// if err != nil {
+// return err
+// }
+//
+// // multierr will call f.Close() when this function returns and
+// // if the operation fails, its append its error into the
+// // returned error.
+// defer multierr.AppendInvoke(&err, multierr.Close(f))
+//
+// scanner := bufio.NewScanner(f)
+// // Similarly, this scheduled scanner.Err to be called and
+// // inspected when the function returns and append its error
+// // into the returned error.
+// defer multierr.AppendInvoke(&err, multierr.Invoke(scanner.Err))
+//
+// // ...
+// }
+//
+// NOTE: If used with a defer, the error variable MUST be a named return.
+//
+// Without defer, AppendInvoke behaves exactly like AppendInto.
+//
+// err := // ...
+// multierr.AppendInvoke(&err, mutltierr.Invoke(foo))
+//
+// // ...is roughly equivalent to...
+//
+// err := // ...
+// multierr.AppendInto(&err, foo())
+//
+// The advantage of the indirection introduced by Invoker is to make it easy
+// to defer the invocation of a function. Without this indirection, the
+// invoked function will be evaluated at the time of the defer block rather
+// than when the function returns.
+//
+// // BAD: This is likely not what the caller intended. This will evaluate
+// // foo() right away and append its result into the error when the
+// // function returns.
+// defer multierr.AppendInto(&err, foo())
+//
+// // GOOD: This will defer invocation of foo unutil the function returns.
+// defer multierr.AppendInvoke(&err, multierr.Invoke(foo))
+//
+// multierr provides a few Invoker implementations out of the box for
+// convenience. See [Invoker] for more information.
+func AppendInvoke(into *error, invoker Invoker) {
+ AppendInto(into, invoker.Invoke())
+}
+
+// AppendFunc is a shorthand for [AppendInvoke].
+// It allows using function or method value directly
+// without having to wrap it into an [Invoker] interface.
+//
+// func doSomething(...) (err error) {
+// w, err := startWorker(...)
+// if err != nil {
+// return err
+// }
+//
+// // multierr will call w.Stop() when this function returns and
+// // if the operation fails, it appends its error into the
+// // returned error.
+// defer multierr.AppendFunc(&err, w.Stop)
+// }
+func AppendFunc(into *error, fn func() error) {
+ AppendInvoke(into, Invoke(fn))
+}
diff --git a/vendor/go.uber.org/atomic/error_ext.go b/vendor/go.uber.org/multierr/error_post_go120.go
similarity index 65%
rename from vendor/go.uber.org/atomic/error_ext.go
rename to vendor/go.uber.org/multierr/error_post_go120.go
index ffe0be21c..a173f9c25 100644
--- a/vendor/go.uber.org/atomic/error_ext.go
+++ b/vendor/go.uber.org/multierr/error_post_go120.go
@@ -1,4 +1,4 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
+// Copyright (c) 2017-2023 Uber Technologies, Inc.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
@@ -18,22 +18,31 @@
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
-package atomic
+//go:build go1.20
+// +build go1.20
-// atomic.Value panics on nil inputs, or if the underlying type changes.
-// Stabilize by always storing a custom struct that we control.
+package multierr
-//go:generate bin/gen-atomicwrapper -name=Error -type=error -wrapped=Value -pack=packError -unpack=unpackError -file=error.go
-
-type packedError struct{ Value error }
+// Unwrap returns a list of errors wrapped by this multierr.
+func (merr *multiError) Unwrap() []error {
+ return merr.Errors()
+}
-func packError(v error) interface{} {
- return packedError{v}
+type multipleErrors interface {
+ Unwrap() []error
}
-func unpackError(v interface{}) error {
- if err, ok := v.(packedError); ok {
- return err.Value
+func extractErrors(err error) []error {
+ if err == nil {
+ return nil
}
- return nil
+
+ // check if the given err is an Unwrapable error that
+ // implements multipleErrors interface.
+ eg, ok := err.(multipleErrors)
+ if !ok {
+ return []error{err}
+ }
+
+ return append(([]error)(nil), eg.Unwrap()...)
}
diff --git a/vendor/go.uber.org/multierr/go113.go b/vendor/go.uber.org/multierr/error_pre_go120.go
similarity index 66%
rename from vendor/go.uber.org/multierr/go113.go
rename to vendor/go.uber.org/multierr/error_pre_go120.go
index 264b0eac0..93872a3fc 100644
--- a/vendor/go.uber.org/multierr/go113.go
+++ b/vendor/go.uber.org/multierr/error_pre_go120.go
@@ -1,4 +1,4 @@
-// Copyright (c) 2019 Uber Technologies, Inc.
+// Copyright (c) 2017-2023 Uber Technologies, Inc.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
@@ -18,12 +18,19 @@
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
-// +build go1.13
+//go:build !go1.20
+// +build !go1.20
package multierr
import "errors"
+// Versions of Go before 1.20 did not support the Unwrap() []error method.
+// This provides a similar behavior by implementing the Is(..) and As(..)
+// methods.
+// See the errors.Join proposal for details:
+// https://github.com/golang/go/issues/53435
+
// As attempts to find the first error in the error list that matches the type
// of the value that target points to.
//
@@ -50,3 +57,23 @@ func (merr *multiError) Is(target error) bool {
}
return false
}
+
+func extractErrors(err error) []error {
+ if err == nil {
+ return nil
+ }
+
+ // Note that we're casting to multiError, not errorGroup. Our contract is
+ // that returned errors MAY implement errorGroup. Errors, however, only
+ // has special behavior for multierr-specific error objects.
+ //
+ // This behavior can be expanded in the future but I think it's prudent to
+ // start with as little as possible in terms of contract and possibility
+ // of misuse.
+ eg, ok := err.(*multiError)
+ if !ok {
+ return []error{err}
+ }
+
+ return append(([]error)(nil), eg.Errors()...)
+}
diff --git a/vendor/go.uber.org/multierr/glide.yaml b/vendor/go.uber.org/multierr/glide.yaml
deleted file mode 100644
index 6ef084ec2..000000000
--- a/vendor/go.uber.org/multierr/glide.yaml
+++ /dev/null
@@ -1,8 +0,0 @@
-package: go.uber.org/multierr
-import:
-- package: go.uber.org/atomic
- version: ^1
-testImport:
-- package: github.com/stretchr/testify
- subpackages:
- - assert
diff --git a/vendor/go.uber.org/zap/.golangci.yml b/vendor/go.uber.org/zap/.golangci.yml
new file mode 100644
index 000000000..fbc6df790
--- /dev/null
+++ b/vendor/go.uber.org/zap/.golangci.yml
@@ -0,0 +1,77 @@
+output:
+ # Make output more digestible with quickfix in vim/emacs/etc.
+ sort-results: true
+ print-issued-lines: false
+
+linters:
+ # We'll track the golangci-lint default linters manually
+ # instead of letting them change without our control.
+ disable-all: true
+ enable:
+ # golangci-lint defaults:
+ - errcheck
+ - gosimple
+ - govet
+ - ineffassign
+ - staticcheck
+ - unused
+
+ # Our own extras:
+ - gofmt
+ - nolintlint # lints nolint directives
+ - revive
+
+linters-settings:
+ govet:
+ # These govet checks are disabled by default, but they're useful.
+ enable:
+ - niliness
+ - reflectvaluecompare
+ - sortslice
+ - unusedwrite
+
+ errcheck:
+ exclude-functions:
+ # These methods can not fail.
+ # They operate on an in-memory buffer.
+ - (*go.uber.org/zap/buffer.Buffer).Write
+ - (*go.uber.org/zap/buffer.Buffer).WriteByte
+ - (*go.uber.org/zap/buffer.Buffer).WriteString
+
+ - (*go.uber.org/zap/zapio.Writer).Close
+ - (*go.uber.org/zap/zapio.Writer).Sync
+ - (*go.uber.org/zap/zapio.Writer).Write
+ # Write to zapio.Writer cannot fail,
+ # so io.WriteString on it cannot fail.
+ - io.WriteString(*go.uber.org/zap/zapio.Writer)
+
+ # Writing a plain string to a fmt.State cannot fail.
+ - io.WriteString(fmt.State)
+
+issues:
+ # Print all issues reported by all linters.
+ max-issues-per-linter: 0
+ max-same-issues: 0
+
+ # Don't ignore some of the issues that golangci-lint considers okay.
+ # This includes documenting all exported entities.
+ exclude-use-default: false
+
+ exclude-rules:
+ # Don't warn on unused parameters.
+ # Parameter names are useful; replacing them with '_' is undesirable.
+ - linters: [revive]
+ text: 'unused-parameter: parameter \S+ seems to be unused, consider removing or renaming it as _'
+
+ # staticcheck already has smarter checks for empty blocks.
+ # revive's empty-block linter has false positives.
+ # For example, as of writing this, the following is not allowed.
+ # for foo() { }
+ - linters: [revive]
+ text: 'empty-block: this block is empty, you can remove it'
+
+ # Ignore logger.Sync() errcheck failures in example_test.go
+ # since those are intended to be uncomplicated examples.
+ - linters: [errcheck]
+ path: example_test.go
+ text: 'Error return value of `logger.Sync` is not checked'
diff --git a/vendor/go.uber.org/zap/CHANGELOG.md b/vendor/go.uber.org/zap/CHANGELOG.md
index 0db1f9f15..11b465976 100644
--- a/vendor/go.uber.org/zap/CHANGELOG.md
+++ b/vendor/go.uber.org/zap/CHANGELOG.md
@@ -1,7 +1,39 @@
# Changelog
All notable changes to this project will be documented in this file.
-This project adheres to [Semantic Versioning](http://semver.org/spec/v2.0.0.html).
+This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html).
+
+## 1.26.0 (14 Sep 2023)
+Enhancements:
+* [#1319][]: Add `WithLazy` method to `Logger` which lazily evaluates the structured
+context.
+* [#1350][]: String encoding is much (~50%) faster now.
+
+Thanks to @jquirke, @cdvr1993 for their contributions to this release.
+
+[#1319]: https://github.com/uber-go/zap/pull/1319
+[#1350]: https://github.com/uber-go/zap/pull/1350
+
+## 1.25.0 (1 Aug 2023)
+
+This release contains several improvements including performance, API additions,
+and two new experimental packages whose APIs are unstable and may change in the
+future.
+
+Enhancements:
+* [#1246][]: Add `zap/exp/zapslog` package for integration with slog.
+* [#1273][]: Add `Name` to `Logger` which returns the Logger's name if one is set.
+* [#1281][]: Add `zap/exp/expfield` package which contains helper methods
+`Str` and `Strs` for constructing String-like zap.Fields.
+* [#1310][]: Reduce stack size on `Any`.
+
+Thanks to @knight42, @dzakaammar, @bcspragu, and @rexywork for their contributions
+to this release.
+
+[#1246]: https://github.com/uber-go/zap/pull/1246
+[#1273]: https://github.com/uber-go/zap/pull/1273
+[#1281]: https://github.com/uber-go/zap/pull/1281
+[#1310]: https://github.com/uber-go/zap/pull/1310
## 1.24.0 (30 Nov 2022)
@@ -27,7 +59,6 @@ Enhancements:
[#1147]: https://github.com/uber-go/zap/pull/1147
[#1155]: https://github.com/uber-go/zap/pull/1155
-
## 1.22.0 (8 Aug 2022)
Enhancements:
@@ -176,6 +207,16 @@ Enhancements:
Thanks to @ash2k, @FMLS, @jimmystewpot, @Oncilla, @tsoslow, @tylitianrui, @withshubh, and @wziww for their contributions to this release.
+[#865]: https://github.com/uber-go/zap/pull/865
+[#867]: https://github.com/uber-go/zap/pull/867
+[#881]: https://github.com/uber-go/zap/pull/881
+[#903]: https://github.com/uber-go/zap/pull/903
+[#912]: https://github.com/uber-go/zap/pull/912
+[#913]: https://github.com/uber-go/zap/pull/913
+[#928]: https://github.com/uber-go/zap/pull/928
+[#931]: https://github.com/uber-go/zap/pull/931
+[#936]: https://github.com/uber-go/zap/pull/936
+
## 1.16.0 (1 Sep 2020)
Bugfixes:
@@ -197,6 +238,17 @@ Enhancements:
Thanks to @SteelPhase, @tmshn, @lixingwang, @wyxloading, @moul, @segevfiner, @andy-retailnext and @jcorbin for their contributions to this release.
+[#629]: https://github.com/uber-go/zap/pull/629
+[#697]: https://github.com/uber-go/zap/pull/697
+[#828]: https://github.com/uber-go/zap/pull/828
+[#835]: https://github.com/uber-go/zap/pull/835
+[#843]: https://github.com/uber-go/zap/pull/843
+[#844]: https://github.com/uber-go/zap/pull/844
+[#852]: https://github.com/uber-go/zap/pull/852
+[#854]: https://github.com/uber-go/zap/pull/854
+[#861]: https://github.com/uber-go/zap/pull/861
+[#862]: https://github.com/uber-go/zap/pull/862
+
## 1.15.0 (23 Apr 2020)
Bugfixes:
@@ -213,6 +265,11 @@ Enhancements:
Thanks to @danielbprice for their contributions to this release.
+[#804]: https://github.com/uber-go/zap/pull/804
+[#812]: https://github.com/uber-go/zap/pull/812
+[#806]: https://github.com/uber-go/zap/pull/806
+[#813]: https://github.com/uber-go/zap/pull/813
+
## 1.14.1 (14 Mar 2020)
Bugfixes:
@@ -225,6 +282,10 @@ Bugfixes:
Thanks to @YashishDua for their contributions to this release.
+[#791]: https://github.com/uber-go/zap/pull/791
+[#795]: https://github.com/uber-go/zap/pull/795
+[#799]: https://github.com/uber-go/zap/pull/799
+
## 1.14.0 (20 Feb 2020)
Enhancements:
@@ -235,6 +296,11 @@ Enhancements:
Thanks to @caibirdme for their contributions to this release.
+[#771]: https://github.com/uber-go/zap/pull/771
+[#773]: https://github.com/uber-go/zap/pull/773
+[#775]: https://github.com/uber-go/zap/pull/775
+[#786]: https://github.com/uber-go/zap/pull/786
+
## 1.13.0 (13 Nov 2019)
Enhancements:
@@ -243,11 +309,15 @@ Enhancements:
Thanks to @jbizzle for their contributions to this release.
+[#758]: https://github.com/uber-go/zap/pull/758
+
## 1.12.0 (29 Oct 2019)
Enhancements:
* [#751][]: Migrate to Go modules.
+[#751]: https://github.com/uber-go/zap/pull/751
+
## 1.11.0 (21 Oct 2019)
Enhancements:
@@ -256,6 +326,9 @@ Enhancements:
Thanks to @juicemia, @uhthomas for their contributions to this release.
+[#725]: https://github.com/uber-go/zap/pull/725
+[#736]: https://github.com/uber-go/zap/pull/736
+
## 1.10.0 (29 Apr 2019)
Bugfixes:
@@ -273,12 +346,20 @@ Enhancements:
Thanks to @iaroslav-ciupin, @lelenanam, @joa, @NWilson for their contributions
to this release.
+[#657]: https://github.com/uber-go/zap/pull/657
+[#706]: https://github.com/uber-go/zap/pull/706
+[#610]: https://github.com/uber-go/zap/pull/610
+[#675]: https://github.com/uber-go/zap/pull/675
+[#704]: https://github.com/uber-go/zap/pull/704
+
## v1.9.1 (06 Aug 2018)
Bugfixes:
* [#614][]: MapObjectEncoder should not ignore empty slices.
+[#614]: https://github.com/uber-go/zap/pull/614
+
## v1.9.0 (19 Jul 2018)
Enhancements:
@@ -288,6 +369,10 @@ Enhancements:
Thanks to @nfarah86, @AlekSi, @JeanMertz, @philippgille, @etsangsplk, and
@dimroc for their contributions to this release.
+[#602]: https://github.com/uber-go/zap/pull/602
+[#572]: https://github.com/uber-go/zap/pull/572
+[#606]: https://github.com/uber-go/zap/pull/606
+
## v1.8.0 (13 Apr 2018)
Enhancements:
@@ -301,11 +386,18 @@ Bugfixes:
Thanks to @DiSiqueira and @djui for their contributions to this release.
+[#508]: https://github.com/uber-go/zap/pull/508
+[#518]: https://github.com/uber-go/zap/pull/518
+[#577]: https://github.com/uber-go/zap/pull/577
+[#574]: https://github.com/uber-go/zap/pull/574
+
## v1.7.1 (25 Sep 2017)
Bugfixes:
* [#504][]: Store strings when using AddByteString with the map encoder.
+[#504]: https://github.com/uber-go/zap/pull/504
+
## v1.7.0 (21 Sep 2017)
Enhancements:
@@ -313,6 +405,8 @@ Enhancements:
* [#487][]: Add `NewStdLogAt`, which extends `NewStdLog` by allowing the user
to specify the level of the logged messages.
+[#487]: https://github.com/uber-go/zap/pull/487
+
## v1.6.0 (30 Aug 2017)
Enhancements:
@@ -321,6 +415,9 @@ Enhancements:
* [#490][]: Add a `ContextMap` method to observer logs for simpler
field validation in tests.
+[#490]: https://github.com/uber-go/zap/pull/490
+[#491]: https://github.com/uber-go/zap/pull/491
+
## v1.5.0 (22 Jul 2017)
Enhancements:
@@ -334,6 +431,11 @@ Bugfixes:
Thanks to @richard-tunein and @pavius for their contributions to this release.
+[#477]: https://github.com/uber-go/zap/pull/477
+[#465]: https://github.com/uber-go/zap/pull/465
+[#460]: https://github.com/uber-go/zap/pull/460
+[#470]: https://github.com/uber-go/zap/pull/470
+
## v1.4.1 (08 Jun 2017)
This release fixes two bugs.
@@ -343,6 +445,9 @@ Bugfixes:
* [#435][]: Support a variety of case conventions when unmarshaling levels.
* [#444][]: Fix a panic in the observer.
+[#435]: https://github.com/uber-go/zap/pull/435
+[#444]: https://github.com/uber-go/zap/pull/444
+
## v1.4.0 (12 May 2017)
This release adds a few small features and is fully backward-compatible.
@@ -355,6 +460,10 @@ Enhancements:
* [#431][]: Make `zap.AtomicLevel` implement `fmt.Stringer`, which makes a
variety of operations a bit simpler.
+[#424]: https://github.com/uber-go/zap/pull/424
+[#425]: https://github.com/uber-go/zap/pull/425
+[#431]: https://github.com/uber-go/zap/pull/431
+
## v1.3.0 (25 Apr 2017)
This release adds an enhancement to zap's testing helpers as well as the
@@ -366,6 +475,9 @@ Enhancements:
particularly useful when testing the `SugaredLogger`.
* [#416][]: Make `AtomicLevel` implement `encoding.TextMarshaler`.
+[#415]: https://github.com/uber-go/zap/pull/415
+[#416]: https://github.com/uber-go/zap/pull/416
+
## v1.2.0 (13 Apr 2017)
This release adds a gRPC compatibility wrapper. It is fully backward-compatible.
@@ -375,6 +487,8 @@ Enhancements:
* [#402][]: Add a `zapgrpc` package that wraps zap's Logger and implements
`grpclog.Logger`.
+[#402]: https://github.com/uber-go/zap/pull/402
+
## v1.1.0 (31 Mar 2017)
This release fixes two bugs and adds some enhancements to zap's testing helpers.
@@ -392,6 +506,10 @@ Enhancements:
Thanks to @moitias for contributing to this release.
+[#385]: https://github.com/uber-go/zap/pull/385
+[#396]: https://github.com/uber-go/zap/pull/396
+[#386]: https://github.com/uber-go/zap/pull/386
+
## v1.0.0 (14 Mar 2017)
This is zap's first stable release. All exported APIs are now final, and no
@@ -437,6 +555,20 @@ Enhancements:
Thanks to @suyash, @htrendev, @flisky, @Ulexus, and @skipor for their
contributions to this release.
+[#366]: https://github.com/uber-go/zap/pull/366
+[#364]: https://github.com/uber-go/zap/pull/364
+[#371]: https://github.com/uber-go/zap/pull/371
+[#362]: https://github.com/uber-go/zap/pull/362
+[#369]: https://github.com/uber-go/zap/pull/369
+[#347]: https://github.com/uber-go/zap/pull/347
+[#373]: https://github.com/uber-go/zap/pull/373
+[#348]: https://github.com/uber-go/zap/pull/348
+[#327]: https://github.com/uber-go/zap/pull/327
+[#376]: https://github.com/uber-go/zap/pull/376
+[#346]: https://github.com/uber-go/zap/pull/346
+[#365]: https://github.com/uber-go/zap/pull/365
+[#372]: https://github.com/uber-go/zap/pull/372
+
## v1.0.0-rc.3 (7 Mar 2017)
This is the third release candidate for zap's stable release. There are no
@@ -458,6 +590,11 @@ Enhancements:
Thanks to @ansel1 and @suyash for their contributions to this release.
+[#339]: https://github.com/uber-go/zap/pull/339
+[#307]: https://github.com/uber-go/zap/pull/307
+[#353]: https://github.com/uber-go/zap/pull/353
+[#311]: https://github.com/uber-go/zap/pull/311
+
## v1.0.0-rc.2 (21 Feb 2017)
This is the second release candidate for zap's stable release. It includes two
@@ -495,6 +632,15 @@ Enhancements:
Thanks to @skipor and @chapsuk for their contributions to this release.
+[#316]: https://github.com/uber-go/zap/pull/316
+[#309]: https://github.com/uber-go/zap/pull/309
+[#317]: https://github.com/uber-go/zap/pull/317
+[#321]: https://github.com/uber-go/zap/pull/321
+[#325]: https://github.com/uber-go/zap/pull/325
+[#333]: https://github.com/uber-go/zap/pull/333
+[#326]: https://github.com/uber-go/zap/pull/326
+[#300]: https://github.com/uber-go/zap/pull/300
+
## v1.0.0-rc.1 (14 Feb 2017)
This is the first release candidate for zap's stable release. There are multiple
@@ -523,95 +669,3 @@ backward compatibility concerns and all functionality is new.
Early zap adopters should pin to the 0.1.x minor version until they're ready to
upgrade to the upcoming stable release.
-
-[#316]: https://github.com/uber-go/zap/pull/316
-[#309]: https://github.com/uber-go/zap/pull/309
-[#317]: https://github.com/uber-go/zap/pull/317
-[#321]: https://github.com/uber-go/zap/pull/321
-[#325]: https://github.com/uber-go/zap/pull/325
-[#333]: https://github.com/uber-go/zap/pull/333
-[#326]: https://github.com/uber-go/zap/pull/326
-[#300]: https://github.com/uber-go/zap/pull/300
-[#339]: https://github.com/uber-go/zap/pull/339
-[#307]: https://github.com/uber-go/zap/pull/307
-[#353]: https://github.com/uber-go/zap/pull/353
-[#311]: https://github.com/uber-go/zap/pull/311
-[#366]: https://github.com/uber-go/zap/pull/366
-[#364]: https://github.com/uber-go/zap/pull/364
-[#371]: https://github.com/uber-go/zap/pull/371
-[#362]: https://github.com/uber-go/zap/pull/362
-[#369]: https://github.com/uber-go/zap/pull/369
-[#347]: https://github.com/uber-go/zap/pull/347
-[#373]: https://github.com/uber-go/zap/pull/373
-[#348]: https://github.com/uber-go/zap/pull/348
-[#327]: https://github.com/uber-go/zap/pull/327
-[#376]: https://github.com/uber-go/zap/pull/376
-[#346]: https://github.com/uber-go/zap/pull/346
-[#365]: https://github.com/uber-go/zap/pull/365
-[#372]: https://github.com/uber-go/zap/pull/372
-[#385]: https://github.com/uber-go/zap/pull/385
-[#396]: https://github.com/uber-go/zap/pull/396
-[#386]: https://github.com/uber-go/zap/pull/386
-[#402]: https://github.com/uber-go/zap/pull/402
-[#415]: https://github.com/uber-go/zap/pull/415
-[#416]: https://github.com/uber-go/zap/pull/416
-[#424]: https://github.com/uber-go/zap/pull/424
-[#425]: https://github.com/uber-go/zap/pull/425
-[#431]: https://github.com/uber-go/zap/pull/431
-[#435]: https://github.com/uber-go/zap/pull/435
-[#444]: https://github.com/uber-go/zap/pull/444
-[#477]: https://github.com/uber-go/zap/pull/477
-[#465]: https://github.com/uber-go/zap/pull/465
-[#460]: https://github.com/uber-go/zap/pull/460
-[#470]: https://github.com/uber-go/zap/pull/470
-[#487]: https://github.com/uber-go/zap/pull/487
-[#490]: https://github.com/uber-go/zap/pull/490
-[#491]: https://github.com/uber-go/zap/pull/491
-[#504]: https://github.com/uber-go/zap/pull/504
-[#508]: https://github.com/uber-go/zap/pull/508
-[#518]: https://github.com/uber-go/zap/pull/518
-[#577]: https://github.com/uber-go/zap/pull/577
-[#574]: https://github.com/uber-go/zap/pull/574
-[#602]: https://github.com/uber-go/zap/pull/602
-[#572]: https://github.com/uber-go/zap/pull/572
-[#606]: https://github.com/uber-go/zap/pull/606
-[#614]: https://github.com/uber-go/zap/pull/614
-[#657]: https://github.com/uber-go/zap/pull/657
-[#706]: https://github.com/uber-go/zap/pull/706
-[#610]: https://github.com/uber-go/zap/pull/610
-[#675]: https://github.com/uber-go/zap/pull/675
-[#704]: https://github.com/uber-go/zap/pull/704
-[#725]: https://github.com/uber-go/zap/pull/725
-[#736]: https://github.com/uber-go/zap/pull/736
-[#751]: https://github.com/uber-go/zap/pull/751
-[#758]: https://github.com/uber-go/zap/pull/758
-[#771]: https://github.com/uber-go/zap/pull/771
-[#773]: https://github.com/uber-go/zap/pull/773
-[#775]: https://github.com/uber-go/zap/pull/775
-[#786]: https://github.com/uber-go/zap/pull/786
-[#791]: https://github.com/uber-go/zap/pull/791
-[#795]: https://github.com/uber-go/zap/pull/795
-[#799]: https://github.com/uber-go/zap/pull/799
-[#804]: https://github.com/uber-go/zap/pull/804
-[#812]: https://github.com/uber-go/zap/pull/812
-[#806]: https://github.com/uber-go/zap/pull/806
-[#813]: https://github.com/uber-go/zap/pull/813
-[#629]: https://github.com/uber-go/zap/pull/629
-[#697]: https://github.com/uber-go/zap/pull/697
-[#828]: https://github.com/uber-go/zap/pull/828
-[#835]: https://github.com/uber-go/zap/pull/835
-[#843]: https://github.com/uber-go/zap/pull/843
-[#844]: https://github.com/uber-go/zap/pull/844
-[#852]: https://github.com/uber-go/zap/pull/852
-[#854]: https://github.com/uber-go/zap/pull/854
-[#861]: https://github.com/uber-go/zap/pull/861
-[#862]: https://github.com/uber-go/zap/pull/862
-[#865]: https://github.com/uber-go/zap/pull/865
-[#867]: https://github.com/uber-go/zap/pull/867
-[#881]: https://github.com/uber-go/zap/pull/881
-[#903]: https://github.com/uber-go/zap/pull/903
-[#912]: https://github.com/uber-go/zap/pull/912
-[#913]: https://github.com/uber-go/zap/pull/913
-[#928]: https://github.com/uber-go/zap/pull/928
-[#931]: https://github.com/uber-go/zap/pull/931
-[#936]: https://github.com/uber-go/zap/pull/936
diff --git a/vendor/go.uber.org/zap/Makefile b/vendor/go.uber.org/zap/Makefile
index 9b1bc3b0e..eb1cee53b 100644
--- a/vendor/go.uber.org/zap/Makefile
+++ b/vendor/go.uber.org/zap/Makefile
@@ -1,50 +1,51 @@
-export GOBIN ?= $(shell pwd)/bin
+# Directory containing the Makefile.
+PROJECT_ROOT = $(dir $(abspath $(lastword $(MAKEFILE_LIST))))
-GOLINT = $(GOBIN)/golint
-STATICCHECK = $(GOBIN)/staticcheck
+export GOBIN ?= $(PROJECT_ROOT)/bin
+export PATH := $(GOBIN):$(PATH)
+
+GOVULNCHECK = $(GOBIN)/govulncheck
BENCH_FLAGS ?= -cpuprofile=cpu.pprof -memprofile=mem.pprof -benchmem
# Directories containing independent Go modules.
-#
-# We track coverage only for the main module.
-MODULE_DIRS = . ./benchmarks ./zapgrpc/internal/test
+MODULE_DIRS = . ./exp ./benchmarks ./zapgrpc/internal/test
-# Many Go tools take file globs or directories as arguments instead of packages.
-GO_FILES := $(shell \
- find . '(' -path '*/.*' -o -path './vendor' ')' -prune \
- -o -name '*.go' -print | cut -b3-)
+# Directories that we want to track coverage for.
+COVER_DIRS = . ./exp
.PHONY: all
all: lint test
.PHONY: lint
-lint: $(GOLINT) $(STATICCHECK)
- @rm -rf lint.log
- @echo "Checking formatting..."
- @gofmt -d -s $(GO_FILES) 2>&1 | tee lint.log
- @echo "Checking vet..."
- @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && go vet ./... 2>&1) &&) true | tee -a lint.log
- @echo "Checking lint..."
- @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && $(GOLINT) ./... 2>&1) &&) true | tee -a lint.log
- @echo "Checking staticcheck..."
- @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && $(STATICCHECK) ./... 2>&1) &&) true | tee -a lint.log
- @echo "Checking for unresolved FIXMEs..."
- @git grep -i fixme | grep -v -e Makefile | tee -a lint.log
- @echo "Checking for license headers..."
- @./checklicense.sh | tee -a lint.log
- @[ ! -s lint.log ]
- @echo "Checking 'go mod tidy'..."
- @make tidy
- @if ! git diff --quiet; then \
- echo "'go mod tidy' resulted in changes or working tree is dirty:"; \
- git --no-pager diff; \
- fi
-
-$(GOLINT):
- cd tools && go install golang.org/x/lint/golint
-
-$(STATICCHECK):
- cd tools && go install honnef.co/go/tools/cmd/staticcheck
+lint: golangci-lint tidy-lint license-lint
+
+.PHONY: golangci-lint
+golangci-lint:
+ @$(foreach mod,$(MODULE_DIRS), \
+ (cd $(mod) && \
+ echo "[lint] golangci-lint: $(mod)" && \
+ golangci-lint run --path-prefix $(mod)) &&) true
+
+.PHONY: tidy
+tidy:
+ @$(foreach dir,$(MODULE_DIRS), \
+ (cd $(dir) && go mod tidy) &&) true
+
+.PHONY: tidy-lint
+tidy-lint:
+ @$(foreach mod,$(MODULE_DIRS), \
+ (cd $(mod) && \
+ echo "[lint] tidy: $(mod)" && \
+ go mod tidy && \
+ git diff --exit-code -- go.mod go.sum) &&) true
+
+
+.PHONY: license-lint
+license-lint:
+ ./checklicense.sh
+
+$(GOVULNCHECK):
+ cd tools && go install golang.org/x/vuln/cmd/govulncheck
.PHONY: test
test:
@@ -52,8 +53,10 @@ test:
.PHONY: cover
cover:
- go test -race -coverprofile=cover.out -coverpkg=./... ./...
- go tool cover -html=cover.out -o cover.html
+ @$(foreach dir,$(COVER_DIRS), ( \
+ cd $(dir) && \
+ go test -race -coverprofile=cover.out -coverpkg=./... ./... \
+ && go tool cover -html=cover.out -o cover.html) &&) true
.PHONY: bench
BENCH ?= .
@@ -68,6 +71,6 @@ updatereadme:
rm -f README.md
cat .readme.tmpl | go run internal/readme/readme.go > README.md
-.PHONY: tidy
-tidy:
- @$(foreach dir,$(MODULE_DIRS),(cd $(dir) && go mod tidy) &&) true
+.PHONY: vulncheck
+vulncheck: $(GOVULNCHECK)
+ $(GOVULNCHECK) ./...
diff --git a/vendor/go.uber.org/zap/README.md b/vendor/go.uber.org/zap/README.md
index a553a428c..9de08927b 100644
--- a/vendor/go.uber.org/zap/README.md
+++ b/vendor/go.uber.org/zap/README.md
@@ -54,7 +54,7 @@ and make many small allocations. Put differently, using `encoding/json` and
Zap takes a different approach. It includes a reflection-free, zero-allocation
JSON encoder, and the base `Logger` strives to avoid serialization overhead
and allocations wherever possible. By building the high-level `SugaredLogger`
-on that foundation, zap lets users _choose_ when they need to count every
+on that foundation, zap lets users *choose* when they need to count every
allocation and when they'd prefer a more familiar, loosely typed API.
As measured by its own [benchmarking suite][], not only is zap more performant
@@ -64,40 +64,43 @@ id="anchor-versions">[1](#footnote-versions)
Log a message and 10 fields:
-| Package | Time | Time % to zap | Objects Allocated |
-| :------------------ | :---------: | :-----------: | :---------------: |
-| :zap: zap | 2900 ns/op | +0% | 5 allocs/op |
-| :zap: zap (sugared) | 3475 ns/op | +20% | 10 allocs/op |
-| zerolog | 10639 ns/op | +267% | 32 allocs/op |
-| go-kit | 14434 ns/op | +398% | 59 allocs/op |
-| logrus | 17104 ns/op | +490% | 81 allocs/op |
-| apex/log | 32424 ns/op | +1018% | 66 allocs/op |
-| log15 | 33579 ns/op | +1058% | 76 allocs/op |
+| Package | Time | Time % to zap | Objects Allocated |
+| :------ | :--: | :-----------: | :---------------: |
+| :zap: zap | 1744 ns/op | +0% | 5 allocs/op
+| :zap: zap (sugared) | 2483 ns/op | +42% | 10 allocs/op
+| zerolog | 918 ns/op | -47% | 1 allocs/op
+| go-kit | 5590 ns/op | +221% | 57 allocs/op
+| slog | 5640 ns/op | +223% | 40 allocs/op
+| apex/log | 21184 ns/op | +1115% | 63 allocs/op
+| logrus | 24338 ns/op | +1296% | 79 allocs/op
+| log15 | 26054 ns/op | +1394% | 74 allocs/op
Log a message with a logger that already has 10 fields of context:
-| Package | Time | Time % to zap | Objects Allocated |
-| :------------------ | :---------: | :-----------: | :---------------: |
-| :zap: zap | 373 ns/op | +0% | 0 allocs/op |
-| :zap: zap (sugared) | 452 ns/op | +21% | 1 allocs/op |
-| zerolog | 288 ns/op | -23% | 0 allocs/op |
-| go-kit | 11785 ns/op | +3060% | 58 allocs/op |
-| logrus | 19629 ns/op | +5162% | 70 allocs/op |
-| log15 | 21866 ns/op | +5762% | 72 allocs/op |
-| apex/log | 30890 ns/op | +8182% | 55 allocs/op |
+| Package | Time | Time % to zap | Objects Allocated |
+| :------ | :--: | :-----------: | :---------------: |
+| :zap: zap | 193 ns/op | +0% | 0 allocs/op
+| :zap: zap (sugared) | 227 ns/op | +18% | 1 allocs/op
+| zerolog | 81 ns/op | -58% | 0 allocs/op
+| slog | 322 ns/op | +67% | 0 allocs/op
+| go-kit | 5377 ns/op | +2686% | 56 allocs/op
+| apex/log | 19518 ns/op | +10013% | 53 allocs/op
+| log15 | 19812 ns/op | +10165% | 70 allocs/op
+| logrus | 21997 ns/op | +11297% | 68 allocs/op
Log a static string, without any context or `printf`-style templating:
-| Package | Time | Time % to zap | Objects Allocated |
-| :------------------ | :--------: | :-----------: | :---------------: |
-| :zap: zap | 381 ns/op | +0% | 0 allocs/op |
-| :zap: zap (sugared) | 410 ns/op | +8% | 1 allocs/op |
-| zerolog | 369 ns/op | -3% | 0 allocs/op |
-| standard library | 385 ns/op | +1% | 2 allocs/op |
-| go-kit | 606 ns/op | +59% | 11 allocs/op |
-| logrus | 1730 ns/op | +354% | 25 allocs/op |
-| apex/log | 1998 ns/op | +424% | 7 allocs/op |
-| log15 | 4546 ns/op | +1093% | 22 allocs/op |
+| Package | Time | Time % to zap | Objects Allocated |
+| :------ | :--: | :-----------: | :---------------: |
+| :zap: zap | 165 ns/op | +0% | 0 allocs/op
+| :zap: zap (sugared) | 212 ns/op | +28% | 1 allocs/op
+| zerolog | 95 ns/op | -42% | 0 allocs/op
+| slog | 296 ns/op | +79% | 0 allocs/op
+| go-kit | 415 ns/op | +152% | 9 allocs/op
+| standard library | 422 ns/op | +156% | 2 allocs/op
+| apex/log | 1601 ns/op | +870% | 5 allocs/op
+| logrus | 3017 ns/op | +1728% | 23 allocs/op
+| log15 | 3469 ns/op | +2002% | 20 allocs/op
## Development Status: Stable
@@ -131,3 +134,4 @@ pinned in the [benchmarks/go.mod][] file. [↩](#anchor-versions)
[cov]: https://codecov.io/gh/uber-go/zap
[benchmarking suite]: https://github.com/uber-go/zap/tree/master/benchmarks
[benchmarks/go.mod]: https://github.com/uber-go/zap/blob/master/benchmarks/go.mod
+
diff --git a/vendor/go.uber.org/zap/array.go b/vendor/go.uber.org/zap/array.go
index 5be3704a3..abfccb566 100644
--- a/vendor/go.uber.org/zap/array.go
+++ b/vendor/go.uber.org/zap/array.go
@@ -21,6 +21,7 @@
package zap
import (
+ "fmt"
"time"
"go.uber.org/zap/zapcore"
@@ -94,11 +95,137 @@ func Int8s(key string, nums []int8) Field {
return Array(key, int8s(nums))
}
+// Objects constructs a field with the given key, holding a list of the
+// provided objects that can be marshaled by Zap.
+//
+// Note that these objects must implement zapcore.ObjectMarshaler directly.
+// That is, if you're trying to marshal a []Request, the MarshalLogObject
+// method must be declared on the Request type, not its pointer (*Request).
+// If it's on the pointer, use ObjectValues.
+//
+// Given an object that implements MarshalLogObject on the value receiver, you
+// can log a slice of those objects with Objects like so:
+//
+// type Author struct{ ... }
+// func (a Author) MarshalLogObject(enc zapcore.ObjectEncoder) error
+//
+// var authors []Author = ...
+// logger.Info("loading article", zap.Objects("authors", authors))
+//
+// Similarly, given a type that implements MarshalLogObject on its pointer
+// receiver, you can log a slice of pointers to that object with Objects like
+// so:
+//
+// type Request struct{ ... }
+// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error
+//
+// var requests []*Request = ...
+// logger.Info("sending requests", zap.Objects("requests", requests))
+//
+// If instead, you have a slice of values of such an object, use the
+// ObjectValues constructor.
+//
+// var requests []Request = ...
+// logger.Info("sending requests", zap.ObjectValues("requests", requests))
+func Objects[T zapcore.ObjectMarshaler](key string, values []T) Field {
+ return Array(key, objects[T](values))
+}
+
+type objects[T zapcore.ObjectMarshaler] []T
+
+func (os objects[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error {
+ for _, o := range os {
+ if err := arr.AppendObject(o); err != nil {
+ return err
+ }
+ }
+ return nil
+}
+
+// ObjectMarshalerPtr is a constraint that specifies that the given type
+// implements zapcore.ObjectMarshaler on a pointer receiver.
+type ObjectMarshalerPtr[T any] interface {
+ *T
+ zapcore.ObjectMarshaler
+}
+
+// ObjectValues constructs a field with the given key, holding a list of the
+// provided objects, where pointers to these objects can be marshaled by Zap.
+//
+// Note that pointers to these objects must implement zapcore.ObjectMarshaler.
+// That is, if you're trying to marshal a []Request, the MarshalLogObject
+// method must be declared on the *Request type, not the value (Request).
+// If it's on the value, use Objects.
+//
+// Given an object that implements MarshalLogObject on the pointer receiver,
+// you can log a slice of those objects with ObjectValues like so:
+//
+// type Request struct{ ... }
+// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error
+//
+// var requests []Request = ...
+// logger.Info("sending requests", zap.ObjectValues("requests", requests))
+//
+// If instead, you have a slice of pointers of such an object, use the Objects
+// field constructor.
+//
+// var requests []*Request = ...
+// logger.Info("sending requests", zap.Objects("requests", requests))
+func ObjectValues[T any, P ObjectMarshalerPtr[T]](key string, values []T) Field {
+ return Array(key, objectValues[T, P](values))
+}
+
+type objectValues[T any, P ObjectMarshalerPtr[T]] []T
+
+func (os objectValues[T, P]) MarshalLogArray(arr zapcore.ArrayEncoder) error {
+ for i := range os {
+ // It is necessary for us to explicitly reference the "P" type.
+ // We cannot simply pass "&os[i]" to AppendObject because its type
+ // is "*T", which the type system does not consider as
+ // implementing ObjectMarshaler.
+ // Only the type "P" satisfies ObjectMarshaler, which we have
+ // to convert "*T" to explicitly.
+ var p P = &os[i]
+ if err := arr.AppendObject(p); err != nil {
+ return err
+ }
+ }
+ return nil
+}
+
// Strings constructs a field that carries a slice of strings.
func Strings(key string, ss []string) Field {
return Array(key, stringArray(ss))
}
+// Stringers constructs a field with the given key, holding a list of the
+// output provided by the value's String method
+//
+// Given an object that implements String on the value receiver, you
+// can log a slice of those objects with Objects like so:
+//
+// type Request struct{ ... }
+// func (a Request) String() string
+//
+// var requests []Request = ...
+// logger.Info("sending requests", zap.Stringers("requests", requests))
+//
+// Note that these objects must implement fmt.Stringer directly.
+// That is, if you're trying to marshal a []Request, the String method
+// must be declared on the Request type, not its pointer (*Request).
+func Stringers[T fmt.Stringer](key string, values []T) Field {
+ return Array(key, stringers[T](values))
+}
+
+type stringers[T fmt.Stringer] []T
+
+func (os stringers[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error {
+ for _, o := range os {
+ arr.AppendString(o.String())
+ }
+ return nil
+}
+
// Times constructs a field that carries a slice of time.Times.
func Times(key string, ts []time.Time) Field {
return Array(key, times(ts))
diff --git a/vendor/go.uber.org/zap/array_go118.go b/vendor/go.uber.org/zap/array_go118.go
deleted file mode 100644
index d0d2c49d6..000000000
--- a/vendor/go.uber.org/zap/array_go118.go
+++ /dev/null
@@ -1,156 +0,0 @@
-// Copyright (c) 2022 Uber Technologies, Inc.
-//
-// Permission is hereby granted, free of charge, to any person obtaining a copy
-// of this software and associated documentation files (the "Software"), to deal
-// in the Software without restriction, including without limitation the rights
-// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
-// copies of the Software, and to permit persons to whom the Software is
-// furnished to do so, subject to the following conditions:
-//
-// The above copyright notice and this permission notice shall be included in
-// all copies or substantial portions of the Software.
-//
-// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
-// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
-// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
-// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
-// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
-// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
-// THE SOFTWARE.
-
-//go:build go1.18
-// +build go1.18
-
-package zap
-
-import (
- "fmt"
-
- "go.uber.org/zap/zapcore"
-)
-
-// Objects constructs a field with the given key, holding a list of the
-// provided objects that can be marshaled by Zap.
-//
-// Note that these objects must implement zapcore.ObjectMarshaler directly.
-// That is, if you're trying to marshal a []Request, the MarshalLogObject
-// method must be declared on the Request type, not its pointer (*Request).
-// If it's on the pointer, use ObjectValues.
-//
-// Given an object that implements MarshalLogObject on the value receiver, you
-// can log a slice of those objects with Objects like so:
-//
-// type Author struct{ ... }
-// func (a Author) MarshalLogObject(enc zapcore.ObjectEncoder) error
-//
-// var authors []Author = ...
-// logger.Info("loading article", zap.Objects("authors", authors))
-//
-// Similarly, given a type that implements MarshalLogObject on its pointer
-// receiver, you can log a slice of pointers to that object with Objects like
-// so:
-//
-// type Request struct{ ... }
-// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error
-//
-// var requests []*Request = ...
-// logger.Info("sending requests", zap.Objects("requests", requests))
-//
-// If instead, you have a slice of values of such an object, use the
-// ObjectValues constructor.
-//
-// var requests []Request = ...
-// logger.Info("sending requests", zap.ObjectValues("requests", requests))
-func Objects[T zapcore.ObjectMarshaler](key string, values []T) Field {
- return Array(key, objects[T](values))
-}
-
-type objects[T zapcore.ObjectMarshaler] []T
-
-func (os objects[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error {
- for _, o := range os {
- if err := arr.AppendObject(o); err != nil {
- return err
- }
- }
- return nil
-}
-
-// ObjectMarshalerPtr is a constraint that specifies that the given type
-// implements zapcore.ObjectMarshaler on a pointer receiver.
-type ObjectMarshalerPtr[T any] interface {
- *T
- zapcore.ObjectMarshaler
-}
-
-// ObjectValues constructs a field with the given key, holding a list of the
-// provided objects, where pointers to these objects can be marshaled by Zap.
-//
-// Note that pointers to these objects must implement zapcore.ObjectMarshaler.
-// That is, if you're trying to marshal a []Request, the MarshalLogObject
-// method must be declared on the *Request type, not the value (Request).
-// If it's on the value, use Objects.
-//
-// Given an object that implements MarshalLogObject on the pointer receiver,
-// you can log a slice of those objects with ObjectValues like so:
-//
-// type Request struct{ ... }
-// func (r *Request) MarshalLogObject(enc zapcore.ObjectEncoder) error
-//
-// var requests []Request = ...
-// logger.Info("sending requests", zap.ObjectValues("requests", requests))
-//
-// If instead, you have a slice of pointers of such an object, use the Objects
-// field constructor.
-//
-// var requests []*Request = ...
-// logger.Info("sending requests", zap.Objects("requests", requests))
-func ObjectValues[T any, P ObjectMarshalerPtr[T]](key string, values []T) Field {
- return Array(key, objectValues[T, P](values))
-}
-
-type objectValues[T any, P ObjectMarshalerPtr[T]] []T
-
-func (os objectValues[T, P]) MarshalLogArray(arr zapcore.ArrayEncoder) error {
- for i := range os {
- // It is necessary for us to explicitly reference the "P" type.
- // We cannot simply pass "&os[i]" to AppendObject because its type
- // is "*T", which the type system does not consider as
- // implementing ObjectMarshaler.
- // Only the type "P" satisfies ObjectMarshaler, which we have
- // to convert "*T" to explicitly.
- var p P = &os[i]
- if err := arr.AppendObject(p); err != nil {
- return err
- }
- }
- return nil
-}
-
-// Stringers constructs a field with the given key, holding a list of the
-// output provided by the value's String method
-//
-// Given an object that implements String on the value receiver, you
-// can log a slice of those objects with Objects like so:
-//
-// type Request struct{ ... }
-// func (a Request) String() string
-//
-// var requests []Request = ...
-// logger.Info("sending requests", zap.Stringers("requests", requests))
-//
-// Note that these objects must implement fmt.Stringer directly.
-// That is, if you're trying to marshal a []Request, the String method
-// must be declared on the Request type, not its pointer (*Request).
-func Stringers[T fmt.Stringer](key string, values []T) Field {
- return Array(key, stringers[T](values))
-}
-
-type stringers[T fmt.Stringer] []T
-
-func (os stringers[T]) MarshalLogArray(arr zapcore.ArrayEncoder) error {
- for _, o := range os {
- arr.AppendString(o.String())
- }
- return nil
-}
diff --git a/vendor/go.uber.org/zap/buffer/buffer.go b/vendor/go.uber.org/zap/buffer/buffer.go
index 9e929cd98..27fb5cd5d 100644
--- a/vendor/go.uber.org/zap/buffer/buffer.go
+++ b/vendor/go.uber.org/zap/buffer/buffer.go
@@ -42,6 +42,11 @@ func (b *Buffer) AppendByte(v byte) {
b.bs = append(b.bs, v)
}
+// AppendBytes writes a single byte to the Buffer.
+func (b *Buffer) AppendBytes(v []byte) {
+ b.bs = append(b.bs, v...)
+}
+
// AppendString writes a string to the Buffer.
func (b *Buffer) AppendString(s string) {
b.bs = append(b.bs, s...)
diff --git a/vendor/go.uber.org/zap/buffer/pool.go b/vendor/go.uber.org/zap/buffer/pool.go
index 8fb3e202c..846323360 100644
--- a/vendor/go.uber.org/zap/buffer/pool.go
+++ b/vendor/go.uber.org/zap/buffer/pool.go
@@ -20,25 +20,29 @@
package buffer
-import "sync"
+import (
+ "go.uber.org/zap/internal/pool"
+)
// A Pool is a type-safe wrapper around a sync.Pool.
type Pool struct {
- p *sync.Pool
+ p *pool.Pool[*Buffer]
}
// NewPool constructs a new Pool.
func NewPool() Pool {
- return Pool{p: &sync.Pool{
- New: func() interface{} {
- return &Buffer{bs: make([]byte, 0, _size)}
- },
- }}
+ return Pool{
+ p: pool.New(func() *Buffer {
+ return &Buffer{
+ bs: make([]byte, 0, _size),
+ }
+ }),
+ }
}
// Get retrieves a Buffer from the pool, creating one if necessary.
func (p Pool) Get() *Buffer {
- buf := p.p.Get().(*Buffer)
+ buf := p.p.Get()
buf.Reset()
buf.pool = p
return buf
diff --git a/vendor/go.uber.org/zap/config.go b/vendor/go.uber.org/zap/config.go
index ee6096766..e76e4e64f 100644
--- a/vendor/go.uber.org/zap/config.go
+++ b/vendor/go.uber.org/zap/config.go
@@ -95,6 +95,32 @@ type Config struct {
// NewProductionEncoderConfig returns an opinionated EncoderConfig for
// production environments.
+//
+// Messages encoded with this configuration will be JSON-formatted
+// and will have the following keys by default:
+//
+// - "level": The logging level (e.g. "info", "error").
+// - "ts": The current time in number of seconds since the Unix epoch.
+// - "msg": The message passed to the log statement.
+// - "caller": If available, a short path to the file and line number
+// where the log statement was issued.
+// The logger configuration determines whether this field is captured.
+// - "stacktrace": If available, a stack trace from the line
+// where the log statement was issued.
+// The logger configuration determines whether this field is captured.
+//
+// By default, the following formats are used for different types:
+//
+// - Time is formatted as floating-point number of seconds since the Unix
+// epoch.
+// - Duration is formatted as floating-point number of seconds.
+//
+// You may change these by setting the appropriate fields in the returned
+// object.
+// For example, use the following to change the time encoding format:
+//
+// cfg := zap.NewProductionEncoderConfig()
+// cfg.EncodeTime = zapcore.ISO8601TimeEncoder
func NewProductionEncoderConfig() zapcore.EncoderConfig {
return zapcore.EncoderConfig{
TimeKey: "ts",
@@ -112,11 +138,22 @@ func NewProductionEncoderConfig() zapcore.EncoderConfig {
}
}
-// NewProductionConfig is a reasonable production logging configuration.
-// Logging is enabled at InfoLevel and above.
+// NewProductionConfig builds a reasonable default production logging
+// configuration.
+// Logging is enabled at InfoLevel and above, and uses a JSON encoder.
+// Logs are written to standard error.
+// Stacktraces are included on logs of ErrorLevel and above.
+// DPanicLevel logs will not panic, but will write a stacktrace.
+//
+// Sampling is enabled at 100:100 by default,
+// meaning that after the first 100 log entries
+// with the same level and message in the same second,
+// it will log every 100th entry
+// with the same level and message in the same second.
+// You may disable this behavior by setting Sampling to nil.
//
-// It uses a JSON encoder, writes to standard error, and enables sampling.
-// Stacktraces are automatically included on logs of ErrorLevel and above.
+// See [NewProductionEncoderConfig] for information
+// on the default encoder configuration.
func NewProductionConfig() Config {
return Config{
Level: NewAtomicLevelAt(InfoLevel),
@@ -134,6 +171,32 @@ func NewProductionConfig() Config {
// NewDevelopmentEncoderConfig returns an opinionated EncoderConfig for
// development environments.
+//
+// Messages encoded with this configuration will use Zap's console encoder
+// intended to print human-readable output.
+// It will print log messages with the following information:
+//
+// - The log level (e.g. "INFO", "ERROR").
+// - The time in ISO8601 format (e.g. "2017-01-01T12:00:00Z").
+// - The message passed to the log statement.
+// - If available, a short path to the file and line number
+// where the log statement was issued.
+// The logger configuration determines whether this field is captured.
+// - If available, a stacktrace from the line
+// where the log statement was issued.
+// The logger configuration determines whether this field is captured.
+//
+// By default, the following formats are used for different types:
+//
+// - Time is formatted in ISO8601 format (e.g. "2017-01-01T12:00:00Z").
+// - Duration is formatted as a string (e.g. "1.234s").
+//
+// You may change these by setting the appropriate fields in the returned
+// object.
+// For example, use the following to change the time encoding format:
+//
+// cfg := zap.NewDevelopmentEncoderConfig()
+// cfg.EncodeTime = zapcore.ISO8601TimeEncoder
func NewDevelopmentEncoderConfig() zapcore.EncoderConfig {
return zapcore.EncoderConfig{
// Keys can be anything except the empty string.
@@ -152,12 +215,15 @@ func NewDevelopmentEncoderConfig() zapcore.EncoderConfig {
}
}
-// NewDevelopmentConfig is a reasonable development logging configuration.
-// Logging is enabled at DebugLevel and above.
+// NewDevelopmentConfig builds a reasonable default development logging
+// configuration.
+// Logging is enabled at DebugLevel and above, and uses a console encoder.
+// Logs are written to standard error.
+// Stacktraces are included on logs of WarnLevel and above.
+// DPanicLevel logs will panic.
//
-// It enables development mode (which makes DPanicLevel logs panic), uses a
-// console encoder, writes to standard error, and disables sampling.
-// Stacktraces are automatically included on logs of WarnLevel and above.
+// See [NewDevelopmentEncoderConfig] for information
+// on the default encoder configuration.
func NewDevelopmentConfig() Config {
return Config{
Level: NewAtomicLevelAt(DebugLevel),
diff --git a/vendor/go.uber.org/zap/error.go b/vendor/go.uber.org/zap/error.go
index 65982a51e..45f7b838d 100644
--- a/vendor/go.uber.org/zap/error.go
+++ b/vendor/go.uber.org/zap/error.go
@@ -21,14 +21,13 @@
package zap
import (
- "sync"
-
+ "go.uber.org/zap/internal/pool"
"go.uber.org/zap/zapcore"
)
-var _errArrayElemPool = sync.Pool{New: func() interface{} {
+var _errArrayElemPool = pool.New(func() *errArrayElem {
return &errArrayElem{}
-}}
+})
// Error is shorthand for the common idiom NamedError("error", err).
func Error(err error) Field {
@@ -60,11 +59,14 @@ func (errs errArray) MarshalLogArray(arr zapcore.ArrayEncoder) error {
// potentially an "errorVerbose" attribute, we need to wrap it in a
// type that implements LogObjectMarshaler. To prevent this from
// allocating, pool the wrapper type.
- elem := _errArrayElemPool.Get().(*errArrayElem)
+ elem := _errArrayElemPool.Get()
elem.error = errs[i]
- arr.AppendObject(elem)
+ err := arr.AppendObject(elem)
elem.error = nil
_errArrayElemPool.Put(elem)
+ if err != nil {
+ return err
+ }
}
return nil
}
diff --git a/vendor/go.uber.org/zap/field.go b/vendor/go.uber.org/zap/field.go
index bbb745db5..c8dd3358a 100644
--- a/vendor/go.uber.org/zap/field.go
+++ b/vendor/go.uber.org/zap/field.go
@@ -25,6 +25,7 @@ import (
"math"
"time"
+ "go.uber.org/zap/internal/stacktrace"
"go.uber.org/zap/zapcore"
)
@@ -374,7 +375,7 @@ func StackSkip(key string, skip int) Field {
// from expanding the zapcore.Field union struct to include a byte slice. Since
// taking a stacktrace is already so expensive (~10us), the extra allocation
// is okay.
- return String(key, takeStacktrace(skip+1)) // skip StackSkip
+ return String(key, stacktrace.Take(skip+1)) // skip StackSkip
}
// Duration constructs a field with the given key and value. The encoder
@@ -410,6 +411,63 @@ func Inline(val zapcore.ObjectMarshaler) Field {
}
}
+// Dict constructs a field containing the provided key-value pairs.
+// It acts similar to [Object], but with the fields specified as arguments.
+func Dict(key string, val ...Field) Field {
+ return dictField(key, val)
+}
+
+// We need a function with the signature (string, T) for zap.Any.
+func dictField(key string, val []Field) Field {
+ return Object(key, dictObject(val))
+}
+
+type dictObject []Field
+
+func (d dictObject) MarshalLogObject(enc zapcore.ObjectEncoder) error {
+ for _, f := range d {
+ f.AddTo(enc)
+ }
+ return nil
+}
+
+// We discovered an issue where zap.Any can cause a performance degradation
+// when used in new goroutines.
+//
+// This happens because the compiler assigns 4.8kb (one zap.Field per arm of
+// switch statement) of stack space for zap.Any when it takes the form:
+//
+// switch v := v.(type) {
+// case string:
+// return String(key, v)
+// case int:
+// return Int(key, v)
+// // ...
+// default:
+// return Reflect(key, v)
+// }
+//
+// To avoid this, we use the type switch to assign a value to a single local variable
+// and then call a function on it.
+// The local variable is just a function reference so it doesn't allocate
+// when converted to an interface{}.
+//
+// A fair bit of experimentation went into this.
+// See also:
+//
+// - https://github.com/uber-go/zap/pull/1301
+// - https://github.com/uber-go/zap/pull/1303
+// - https://github.com/uber-go/zap/pull/1304
+// - https://github.com/uber-go/zap/pull/1305
+// - https://github.com/uber-go/zap/pull/1308
+type anyFieldC[T any] func(string, T) Field
+
+func (f anyFieldC[T]) Any(key string, val any) Field {
+ v, _ := val.(T)
+ // val is guaranteed to be a T, except when it's nil.
+ return f(key, v)
+}
+
// Any takes a key and an arbitrary value and chooses the best way to represent
// them as a field, falling back to a reflection-based approach only if
// necessary.
@@ -418,132 +476,138 @@ func Inline(val zapcore.ObjectMarshaler) Field {
// them. To minimize surprises, []byte values are treated as binary blobs, byte
// values are treated as uint8, and runes are always treated as integers.
func Any(key string, value interface{}) Field {
- switch val := value.(type) {
+ var c interface{ Any(string, any) Field }
+
+ switch value.(type) {
case zapcore.ObjectMarshaler:
- return Object(key, val)
+ c = anyFieldC[zapcore.ObjectMarshaler](Object)
case zapcore.ArrayMarshaler:
- return Array(key, val)
+ c = anyFieldC[zapcore.ArrayMarshaler](Array)
+ case []Field:
+ c = anyFieldC[[]Field](dictField)
case bool:
- return Bool(key, val)
+ c = anyFieldC[bool](Bool)
case *bool:
- return Boolp(key, val)
+ c = anyFieldC[*bool](Boolp)
case []bool:
- return Bools(key, val)
+ c = anyFieldC[[]bool](Bools)
case complex128:
- return Complex128(key, val)
+ c = anyFieldC[complex128](Complex128)
case *complex128:
- return Complex128p(key, val)
+ c = anyFieldC[*complex128](Complex128p)
case []complex128:
- return Complex128s(key, val)
+ c = anyFieldC[[]complex128](Complex128s)
case complex64:
- return Complex64(key, val)
+ c = anyFieldC[complex64](Complex64)
case *complex64:
- return Complex64p(key, val)
+ c = anyFieldC[*complex64](Complex64p)
case []complex64:
- return Complex64s(key, val)
+ c = anyFieldC[[]complex64](Complex64s)
case float64:
- return Float64(key, val)
+ c = anyFieldC[float64](Float64)
case *float64:
- return Float64p(key, val)
+ c = anyFieldC[*float64](Float64p)
case []float64:
- return Float64s(key, val)
+ c = anyFieldC[[]float64](Float64s)
case float32:
- return Float32(key, val)
+ c = anyFieldC[float32](Float32)
case *float32:
- return Float32p(key, val)
+ c = anyFieldC[*float32](Float32p)
case []float32:
- return Float32s(key, val)
+ c = anyFieldC[[]float32](Float32s)
case int:
- return Int(key, val)
+ c = anyFieldC[int](Int)
case *int:
- return Intp(key, val)
+ c = anyFieldC[*int](Intp)
case []int:
- return Ints(key, val)
+ c = anyFieldC[[]int](Ints)
case int64:
- return Int64(key, val)
+ c = anyFieldC[int64](Int64)
case *int64:
- return Int64p(key, val)
+ c = anyFieldC[*int64](Int64p)
case []int64:
- return Int64s(key, val)
+ c = anyFieldC[[]int64](Int64s)
case int32:
- return Int32(key, val)
+ c = anyFieldC[int32](Int32)
case *int32:
- return Int32p(key, val)
+ c = anyFieldC[*int32](Int32p)
case []int32:
- return Int32s(key, val)
+ c = anyFieldC[[]int32](Int32s)
case int16:
- return Int16(key, val)
+ c = anyFieldC[int16](Int16)
case *int16:
- return Int16p(key, val)
+ c = anyFieldC[*int16](Int16p)
case []int16:
- return Int16s(key, val)
+ c = anyFieldC[[]int16](Int16s)
case int8:
- return Int8(key, val)
+ c = anyFieldC[int8](Int8)
case *int8:
- return Int8p(key, val)
+ c = anyFieldC[*int8](Int8p)
case []int8:
- return Int8s(key, val)
+ c = anyFieldC[[]int8](Int8s)
case string:
- return String(key, val)
+ c = anyFieldC[string](String)
case *string:
- return Stringp(key, val)
+ c = anyFieldC[*string](Stringp)
case []string:
- return Strings(key, val)
+ c = anyFieldC[[]string](Strings)
case uint:
- return Uint(key, val)
+ c = anyFieldC[uint](Uint)
case *uint:
- return Uintp(key, val)
+ c = anyFieldC[*uint](Uintp)
case []uint:
- return Uints(key, val)
+ c = anyFieldC[[]uint](Uints)
case uint64:
- return Uint64(key, val)
+ c = anyFieldC[uint64](Uint64)
case *uint64:
- return Uint64p(key, val)
+ c = anyFieldC[*uint64](Uint64p)
case []uint64:
- return Uint64s(key, val)
+ c = anyFieldC[[]uint64](Uint64s)
case uint32:
- return Uint32(key, val)
+ c = anyFieldC[uint32](Uint32)
case *uint32:
- return Uint32p(key, val)
+ c = anyFieldC[*uint32](Uint32p)
case []uint32:
- return Uint32s(key, val)
+ c = anyFieldC[[]uint32](Uint32s)
case uint16:
- return Uint16(key, val)
+ c = anyFieldC[uint16](Uint16)
case *uint16:
- return Uint16p(key, val)
+ c = anyFieldC[*uint16](Uint16p)
case []uint16:
- return Uint16s(key, val)
+ c = anyFieldC[[]uint16](Uint16s)
case uint8:
- return Uint8(key, val)
+ c = anyFieldC[uint8](Uint8)
case *uint8:
- return Uint8p(key, val)
+ c = anyFieldC[*uint8](Uint8p)
case []byte:
- return Binary(key, val)
+ c = anyFieldC[[]byte](Binary)
case uintptr:
- return Uintptr(key, val)
+ c = anyFieldC[uintptr](Uintptr)
case *uintptr:
- return Uintptrp(key, val)
+ c = anyFieldC[*uintptr](Uintptrp)
case []uintptr:
- return Uintptrs(key, val)
+ c = anyFieldC[[]uintptr](Uintptrs)
case time.Time:
- return Time(key, val)
+ c = anyFieldC[time.Time](Time)
case *time.Time:
- return Timep(key, val)
+ c = anyFieldC[*time.Time](Timep)
case []time.Time:
- return Times(key, val)
+ c = anyFieldC[[]time.Time](Times)
case time.Duration:
- return Duration(key, val)
+ c = anyFieldC[time.Duration](Duration)
case *time.Duration:
- return Durationp(key, val)
+ c = anyFieldC[*time.Duration](Durationp)
case []time.Duration:
- return Durations(key, val)
+ c = anyFieldC[[]time.Duration](Durations)
case error:
- return NamedError(key, val)
+ c = anyFieldC[error](NamedError)
case []error:
- return Errors(key, val)
+ c = anyFieldC[[]error](Errors)
case fmt.Stringer:
- return Stringer(key, val)
+ c = anyFieldC[fmt.Stringer](Stringer)
default:
- return Reflect(key, val)
+ c = anyFieldC[any](Reflect)
}
+
+ return c.Any(key, value)
}
diff --git a/vendor/go.uber.org/zap/http_handler.go b/vendor/go.uber.org/zap/http_handler.go
index 632b6831a..2be8f6515 100644
--- a/vendor/go.uber.org/zap/http_handler.go
+++ b/vendor/go.uber.org/zap/http_handler.go
@@ -69,6 +69,13 @@ import (
//
// curl -X PUT localhost:8080/log/level -H "Content-Type: application/json" -d '{"level":"debug"}'
func (lvl AtomicLevel) ServeHTTP(w http.ResponseWriter, r *http.Request) {
+ if err := lvl.serveHTTP(w, r); err != nil {
+ w.WriteHeader(http.StatusInternalServerError)
+ fmt.Fprintf(w, "internal error: %v", err)
+ }
+}
+
+func (lvl AtomicLevel) serveHTTP(w http.ResponseWriter, r *http.Request) error {
type errorResponse struct {
Error string `json:"error"`
}
@@ -80,19 +87,20 @@ func (lvl AtomicLevel) ServeHTTP(w http.ResponseWriter, r *http.Request) {
switch r.Method {
case http.MethodGet:
- enc.Encode(payload{Level: lvl.Level()})
+ return enc.Encode(payload{Level: lvl.Level()})
+
case http.MethodPut:
requestedLvl, err := decodePutRequest(r.Header.Get("Content-Type"), r)
if err != nil {
w.WriteHeader(http.StatusBadRequest)
- enc.Encode(errorResponse{Error: err.Error()})
- return
+ return enc.Encode(errorResponse{Error: err.Error()})
}
lvl.SetLevel(requestedLvl)
- enc.Encode(payload{Level: lvl.Level()})
+ return enc.Encode(payload{Level: lvl.Level()})
+
default:
w.WriteHeader(http.StatusMethodNotAllowed)
- enc.Encode(errorResponse{
+ return enc.Encode(errorResponse{
Error: "Only GET and PUT are supported.",
})
}
@@ -129,5 +137,4 @@ func decodePutJSON(body io.Reader) (zapcore.Level, error) {
return 0, errors.New("must specify logging level")
}
return *pld.Level, nil
-
}
diff --git a/vendor/go.uber.org/zap/internal/level_enabler.go b/vendor/go.uber.org/zap/internal/level_enabler.go
index 5f3e3f1b9..40bfed81e 100644
--- a/vendor/go.uber.org/zap/internal/level_enabler.go
+++ b/vendor/go.uber.org/zap/internal/level_enabler.go
@@ -18,6 +18,8 @@
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
+// Package internal and its subpackages hold types and functionality
+// that are not part of Zap's public API.
package internal
import "go.uber.org/zap/zapcore"
diff --git a/vendor/go.uber.org/atomic/string.go b/vendor/go.uber.org/zap/internal/pool/pool.go
similarity index 55%
rename from vendor/go.uber.org/atomic/string.go
rename to vendor/go.uber.org/zap/internal/pool/pool.go
index 225b7a2be..60e9d2c43 100644
--- a/vendor/go.uber.org/atomic/string.go
+++ b/vendor/go.uber.org/zap/internal/pool/pool.go
@@ -1,6 +1,4 @@
-// @generated Code generated by gen-atomicwrapper.
-
-// Copyright (c) 2020 Uber Technologies, Inc.
+// Copyright (c) 2023 Uber Technologies, Inc.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
@@ -20,35 +18,41 @@
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
-package atomic
+// Package pool provides internal pool utilities.
+package pool
-// String is an atomic type-safe wrapper for string values.
-type String struct {
- _ nocmp // disallow non-atomic comparison
+import (
+ "sync"
+)
- v Value
+// A Pool is a generic wrapper around [sync.Pool] to provide strongly-typed
+// object pooling.
+//
+// Note that SA6002 (ref: https://staticcheck.io/docs/checks/#SA6002) will
+// not be detected, so all internal pool use must take care to only store
+// pointer types.
+type Pool[T any] struct {
+ pool sync.Pool
}
-var _zeroString string
-
-// NewString creates a new String.
-func NewString(v string) *String {
- x := &String{}
- if v != _zeroString {
- x.Store(v)
+// New returns a new [Pool] for T, and will use fn to construct new Ts when
+// the pool is empty.
+func New[T any](fn func() T) *Pool[T] {
+ return &Pool[T]{
+ pool: sync.Pool{
+ New: func() any {
+ return fn()
+ },
+ },
}
- return x
}
-// Load atomically loads the wrapped string.
-func (x *String) Load() string {
- if v := x.v.Load(); v != nil {
- return v.(string)
- }
- return _zeroString
+// Get gets a T from the pool, or creates a new one if the pool is empty.
+func (p *Pool[T]) Get() T {
+ return p.pool.Get().(T)
}
-// Store atomically stores the passed string.
-func (x *String) Store(v string) {
- x.v.Store(v)
+// Put returns x into the pool.
+func (p *Pool[T]) Put(x T) {
+ p.pool.Put(x)
}
diff --git a/vendor/go.uber.org/zap/stacktrace.go b/vendor/go.uber.org/zap/internal/stacktrace/stack.go
similarity index 73%
rename from vendor/go.uber.org/zap/stacktrace.go
rename to vendor/go.uber.org/zap/internal/stacktrace/stack.go
index 817a3bde8..82af7551f 100644
--- a/vendor/go.uber.org/zap/stacktrace.go
+++ b/vendor/go.uber.org/zap/internal/stacktrace/stack.go
@@ -1,4 +1,4 @@
-// Copyright (c) 2016 Uber Technologies, Inc.
+// Copyright (c) 2023 Uber Technologies, Inc.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
@@ -18,25 +18,26 @@
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
-package zap
+// Package stacktrace provides support for gathering stack traces
+// efficiently.
+package stacktrace
import (
"runtime"
- "sync"
"go.uber.org/zap/buffer"
"go.uber.org/zap/internal/bufferpool"
+ "go.uber.org/zap/internal/pool"
)
-var _stacktracePool = sync.Pool{
- New: func() interface{} {
- return &stacktrace{
- storage: make([]uintptr, 64),
- }
- },
-}
+var _stackPool = pool.New(func() *Stack {
+ return &Stack{
+ storage: make([]uintptr, 64),
+ }
+})
-type stacktrace struct {
+// Stack is a captured stack trace.
+type Stack struct {
pcs []uintptr // program counters; always a subslice of storage
frames *runtime.Frames
@@ -50,30 +51,30 @@ type stacktrace struct {
storage []uintptr
}
-// stacktraceDepth specifies how deep of a stack trace should be captured.
-type stacktraceDepth int
+// Depth specifies how deep of a stack trace should be captured.
+type Depth int
const (
- // stacktraceFirst captures only the first frame.
- stacktraceFirst stacktraceDepth = iota
+ // First captures only the first frame.
+ First Depth = iota
- // stacktraceFull captures the entire call stack, allocating more
+ // Full captures the entire call stack, allocating more
// storage for it if needed.
- stacktraceFull
+ Full
)
-// captureStacktrace captures a stack trace of the specified depth, skipping
+// Capture captures a stack trace of the specified depth, skipping
// the provided number of frames. skip=0 identifies the caller of
-// captureStacktrace.
+// Capture.
//
// The caller must call Free on the returned stacktrace after using it.
-func captureStacktrace(skip int, depth stacktraceDepth) *stacktrace {
- stack := _stacktracePool.Get().(*stacktrace)
+func Capture(skip int, depth Depth) *Stack {
+ stack := _stackPool.Get()
switch depth {
- case stacktraceFirst:
+ case First:
stack.pcs = stack.storage[:1]
- case stacktraceFull:
+ case Full:
stack.pcs = stack.storage
}
@@ -87,7 +88,7 @@ func captureStacktrace(skip int, depth stacktraceDepth) *stacktrace {
// runtime.Callers truncates the recorded stacktrace if there is no
// room in the provided slice. For the full stack trace, keep expanding
// storage until there are fewer frames than there is room.
- if depth == stacktraceFull {
+ if depth == Full {
pcs := stack.pcs
for numFrames == len(pcs) {
pcs = make([]uintptr, len(pcs)*2)
@@ -109,50 +110,54 @@ func captureStacktrace(skip int, depth stacktraceDepth) *stacktrace {
// Free releases resources associated with this stacktrace
// and returns it back to the pool.
-func (st *stacktrace) Free() {
+func (st *Stack) Free() {
st.frames = nil
st.pcs = nil
- _stacktracePool.Put(st)
+ _stackPool.Put(st)
}
// Count reports the total number of frames in this stacktrace.
// Count DOES NOT change as Next is called.
-func (st *stacktrace) Count() int {
+func (st *Stack) Count() int {
return len(st.pcs)
}
// Next returns the next frame in the stack trace,
// and a boolean indicating whether there are more after it.
-func (st *stacktrace) Next() (_ runtime.Frame, more bool) {
+func (st *Stack) Next() (_ runtime.Frame, more bool) {
return st.frames.Next()
}
-func takeStacktrace(skip int) string {
- stack := captureStacktrace(skip+1, stacktraceFull)
+// Take returns a string representation of the current stacktrace.
+//
+// skip is the number of frames to skip before recording the stack trace.
+// skip=0 identifies the caller of Take.
+func Take(skip int) string {
+ stack := Capture(skip+1, Full)
defer stack.Free()
buffer := bufferpool.Get()
defer buffer.Free()
- stackfmt := newStackFormatter(buffer)
+ stackfmt := NewFormatter(buffer)
stackfmt.FormatStack(stack)
return buffer.String()
}
-// stackFormatter formats a stack trace into a readable string representation.
-type stackFormatter struct {
+// Formatter formats a stack trace into a readable string representation.
+type Formatter struct {
b *buffer.Buffer
nonEmpty bool // whehther we've written at least one frame already
}
-// newStackFormatter builds a new stackFormatter.
-func newStackFormatter(b *buffer.Buffer) stackFormatter {
- return stackFormatter{b: b}
+// NewFormatter builds a new Formatter.
+func NewFormatter(b *buffer.Buffer) Formatter {
+ return Formatter{b: b}
}
// FormatStack formats all remaining frames in the provided stacktrace -- minus
// the final runtime.main/runtime.goexit frame.
-func (sf *stackFormatter) FormatStack(stack *stacktrace) {
+func (sf *Formatter) FormatStack(stack *Stack) {
// Note: On the last iteration, frames.Next() returns false, with a valid
// frame, but we ignore this frame. The last frame is a runtime frame which
// adds noise, since it's only either runtime.main or runtime.goexit.
@@ -162,7 +167,7 @@ func (sf *stackFormatter) FormatStack(stack *stacktrace) {
}
// FormatFrame formats the given frame.
-func (sf *stackFormatter) FormatFrame(frame runtime.Frame) {
+func (sf *Formatter) FormatFrame(frame runtime.Frame) {
if sf.nonEmpty {
sf.b.AppendByte('\n')
}
diff --git a/vendor/go.uber.org/zap/level.go b/vendor/go.uber.org/zap/level.go
index db951e19a..155b208bd 100644
--- a/vendor/go.uber.org/zap/level.go
+++ b/vendor/go.uber.org/zap/level.go
@@ -21,7 +21,8 @@
package zap
import (
- "go.uber.org/atomic"
+ "sync/atomic"
+
"go.uber.org/zap/internal"
"go.uber.org/zap/zapcore"
)
@@ -76,9 +77,9 @@ var _ internal.LeveledEnabler = AtomicLevel{}
// NewAtomicLevel creates an AtomicLevel with InfoLevel and above logging
// enabled.
func NewAtomicLevel() AtomicLevel {
- return AtomicLevel{
- l: atomic.NewInt32(int32(InfoLevel)),
- }
+ lvl := AtomicLevel{l: new(atomic.Int32)}
+ lvl.l.Store(int32(InfoLevel))
+ return lvl
}
// NewAtomicLevelAt is a convenience function that creates an AtomicLevel
diff --git a/vendor/go.uber.org/zap/logger.go b/vendor/go.uber.org/zap/logger.go
index cd44030d1..6205fe48a 100644
--- a/vendor/go.uber.org/zap/logger.go
+++ b/vendor/go.uber.org/zap/logger.go
@@ -27,6 +27,7 @@ import (
"strings"
"go.uber.org/zap/internal/bufferpool"
+ "go.uber.org/zap/internal/stacktrace"
"go.uber.org/zap/zapcore"
)
@@ -173,7 +174,8 @@ func (log *Logger) WithOptions(opts ...Option) *Logger {
}
// With creates a child logger and adds structured context to it. Fields added
-// to the child don't affect the parent, and vice versa.
+// to the child don't affect the parent, and vice versa. Any fields that
+// require evaluation (such as Objects) are evaluated upon invocation of With.
func (log *Logger) With(fields ...Field) *Logger {
if len(fields) == 0 {
return log
@@ -183,6 +185,28 @@ func (log *Logger) With(fields ...Field) *Logger {
return l
}
+// WithLazy creates a child logger and adds structured context to it lazily.
+//
+// The fields are evaluated only if the logger is further chained with [With]
+// or is written to with any of the log level methods.
+// Until that occurs, the logger may retain references to objects inside the fields,
+// and logging will reflect the state of an object at the time of logging,
+// not the time of WithLazy().
+//
+// WithLazy provides a worthwhile performance optimization for contextual loggers
+// when the likelihood of using the child logger is low,
+// such as error paths and rarely taken branches.
+//
+// Similar to [With], fields added to the child don't affect the parent, and vice versa.
+func (log *Logger) WithLazy(fields ...Field) *Logger {
+ if len(fields) == 0 {
+ return log
+ }
+ return log.WithOptions(WrapCore(func(core zapcore.Core) zapcore.Core {
+ return zapcore.NewLazyWith(core, fields)
+ }))
+}
+
// Level reports the minimum enabled level for this logger.
//
// For NopLoggers, this is [zapcore.InvalidLevel].
@@ -199,6 +223,8 @@ func (log *Logger) Check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry {
// Log logs a message at the specified level. The message includes any fields
// passed at the log site, as well as any fields accumulated on the logger.
+// Any Fields that require evaluation (such as Objects) are evaluated upon
+// invocation of Log.
func (log *Logger) Log(lvl zapcore.Level, msg string, fields ...Field) {
if ce := log.check(lvl, msg); ce != nil {
ce.Write(fields...)
@@ -281,9 +307,15 @@ func (log *Logger) Core() zapcore.Core {
return log.core
}
+// Name returns the Logger's underlying name,
+// or an empty string if the logger is unnamed.
+func (log *Logger) Name() string {
+ return log.name
+}
+
func (log *Logger) clone() *Logger {
- copy := *log
- return ©
+ clone := *log
+ return &clone
}
func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry {
@@ -354,17 +386,17 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry {
// Adding the caller or stack trace requires capturing the callers of
// this function. We'll share information between these two.
- stackDepth := stacktraceFirst
+ stackDepth := stacktrace.First
if addStack {
- stackDepth = stacktraceFull
+ stackDepth = stacktrace.Full
}
- stack := captureStacktrace(log.callerSkip+callerSkipOffset, stackDepth)
+ stack := stacktrace.Capture(log.callerSkip+callerSkipOffset, stackDepth)
defer stack.Free()
if stack.Count() == 0 {
if log.addCaller {
fmt.Fprintf(log.errorOutput, "%v Logger.check error: failed to get caller\n", ent.Time.UTC())
- log.errorOutput.Sync()
+ _ = log.errorOutput.Sync()
}
return ce
}
@@ -385,7 +417,7 @@ func (log *Logger) check(lvl zapcore.Level, msg string) *zapcore.CheckedEntry {
buffer := bufferpool.Get()
defer buffer.Free()
- stackfmt := newStackFormatter(buffer)
+ stackfmt := stacktrace.NewFormatter(buffer)
// We've already extracted the first frame, so format that
// separately and defer to stackfmt for the rest.
diff --git a/vendor/go.uber.org/zap/sink.go b/vendor/go.uber.org/zap/sink.go
index 478c9a10f..499772a00 100644
--- a/vendor/go.uber.org/zap/sink.go
+++ b/vendor/go.uber.org/zap/sink.go
@@ -66,7 +66,8 @@ func newSinkRegistry() *sinkRegistry {
factories: make(map[string]func(*url.URL) (Sink, error)),
openFile: os.OpenFile,
}
- sr.RegisterSink(schemeFile, sr.newFileSinkFromURL)
+ // Infallible operation: the registry is empty, so we can't have a conflict.
+ _ = sr.RegisterSink(schemeFile, sr.newFileSinkFromURL)
return sr
}
@@ -154,7 +155,7 @@ func (sr *sinkRegistry) newFileSinkFromPath(path string) (Sink, error) {
case "stderr":
return nopCloserSink{os.Stderr}, nil
}
- return sr.openFile(path, os.O_WRONLY|os.O_APPEND|os.O_CREATE, 0666)
+ return sr.openFile(path, os.O_WRONLY|os.O_APPEND|os.O_CREATE, 0o666)
}
func normalizeScheme(s string) (string, error) {
diff --git a/vendor/go.uber.org/zap/sugar.go b/vendor/go.uber.org/zap/sugar.go
index ac387b3e4..00ac5fe3a 100644
--- a/vendor/go.uber.org/zap/sugar.go
+++ b/vendor/go.uber.org/zap/sugar.go
@@ -122,74 +122,88 @@ func (s *SugaredLogger) Level() zapcore.Level {
return zapcore.LevelOf(s.base.core)
}
-// Debug uses fmt.Sprint to construct and log a message.
+// Debug logs the provided arguments at [DebugLevel].
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) Debug(args ...interface{}) {
s.log(DebugLevel, "", args, nil)
}
-// Info uses fmt.Sprint to construct and log a message.
+// Info logs the provided arguments at [InfoLevel].
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) Info(args ...interface{}) {
s.log(InfoLevel, "", args, nil)
}
-// Warn uses fmt.Sprint to construct and log a message.
+// Warn logs the provided arguments at [WarnLevel].
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) Warn(args ...interface{}) {
s.log(WarnLevel, "", args, nil)
}
-// Error uses fmt.Sprint to construct and log a message.
+// Error logs the provided arguments at [ErrorLevel].
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) Error(args ...interface{}) {
s.log(ErrorLevel, "", args, nil)
}
-// DPanic uses fmt.Sprint to construct and log a message. In development, the
-// logger then panics. (See DPanicLevel for details.)
+// DPanic logs the provided arguments at [DPanicLevel].
+// In development, the logger then panics. (See [DPanicLevel] for details.)
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) DPanic(args ...interface{}) {
s.log(DPanicLevel, "", args, nil)
}
-// Panic uses fmt.Sprint to construct and log a message, then panics.
+// Panic constructs a message with the provided arguments and panics.
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) Panic(args ...interface{}) {
s.log(PanicLevel, "", args, nil)
}
-// Fatal uses fmt.Sprint to construct and log a message, then calls os.Exit.
+// Fatal constructs a message with the provided arguments and calls os.Exit.
+// Spaces are added between arguments when neither is a string.
func (s *SugaredLogger) Fatal(args ...interface{}) {
s.log(FatalLevel, "", args, nil)
}
-// Debugf uses fmt.Sprintf to log a templated message.
+// Debugf formats the message according to the format specifier
+// and logs it at [DebugLevel].
func (s *SugaredLogger) Debugf(template string, args ...interface{}) {
s.log(DebugLevel, template, args, nil)
}
-// Infof uses fmt.Sprintf to log a templated message.
+// Infof formats the message according to the format specifier
+// and logs it at [InfoLevel].
func (s *SugaredLogger) Infof(template string, args ...interface{}) {
s.log(InfoLevel, template, args, nil)
}
-// Warnf uses fmt.Sprintf to log a templated message.
+// Warnf formats the message according to the format specifier
+// and logs it at [WarnLevel].
func (s *SugaredLogger) Warnf(template string, args ...interface{}) {
s.log(WarnLevel, template, args, nil)
}
-// Errorf uses fmt.Sprintf to log a templated message.
+// Errorf formats the message according to the format specifier
+// and logs it at [ErrorLevel].
func (s *SugaredLogger) Errorf(template string, args ...interface{}) {
s.log(ErrorLevel, template, args, nil)
}
-// DPanicf uses fmt.Sprintf to log a templated message. In development, the
-// logger then panics. (See DPanicLevel for details.)
+// DPanicf formats the message according to the format specifier
+// and logs it at [DPanicLevel].
+// In development, the logger then panics. (See [DPanicLevel] for details.)
func (s *SugaredLogger) DPanicf(template string, args ...interface{}) {
s.log(DPanicLevel, template, args, nil)
}
-// Panicf uses fmt.Sprintf to log a templated message, then panics.
+// Panicf formats the message according to the format specifier
+// and panics.
func (s *SugaredLogger) Panicf(template string, args ...interface{}) {
s.log(PanicLevel, template, args, nil)
}
-// Fatalf uses fmt.Sprintf to log a templated message, then calls os.Exit.
+// Fatalf formats the message according to the format specifier
+// and calls os.Exit.
func (s *SugaredLogger) Fatalf(template string, args ...interface{}) {
s.log(FatalLevel, template, args, nil)
}
@@ -241,38 +255,45 @@ func (s *SugaredLogger) Fatalw(msg string, keysAndValues ...interface{}) {
s.log(FatalLevel, msg, nil, keysAndValues)
}
-// Debugln uses fmt.Sprintln to construct and log a message.
+// Debugln logs a message at [DebugLevel].
+// Spaces are always added between arguments.
func (s *SugaredLogger) Debugln(args ...interface{}) {
s.logln(DebugLevel, args, nil)
}
-// Infoln uses fmt.Sprintln to construct and log a message.
+// Infoln logs a message at [InfoLevel].
+// Spaces are always added between arguments.
func (s *SugaredLogger) Infoln(args ...interface{}) {
s.logln(InfoLevel, args, nil)
}
-// Warnln uses fmt.Sprintln to construct and log a message.
+// Warnln logs a message at [WarnLevel].
+// Spaces are always added between arguments.
func (s *SugaredLogger) Warnln(args ...interface{}) {
s.logln(WarnLevel, args, nil)
}
-// Errorln uses fmt.Sprintln to construct and log a message.
+// Errorln logs a message at [ErrorLevel].
+// Spaces are always added between arguments.
func (s *SugaredLogger) Errorln(args ...interface{}) {
s.logln(ErrorLevel, args, nil)
}
-// DPanicln uses fmt.Sprintln to construct and log a message. In development, the
-// logger then panics. (See DPanicLevel for details.)
+// DPanicln logs a message at [DPanicLevel].
+// In development, the logger then panics. (See [DPanicLevel] for details.)
+// Spaces are always added between arguments.
func (s *SugaredLogger) DPanicln(args ...interface{}) {
s.logln(DPanicLevel, args, nil)
}
-// Panicln uses fmt.Sprintln to construct and log a message, then panics.
+// Panicln logs a message at [PanicLevel] and panics.
+// Spaces are always added between arguments.
func (s *SugaredLogger) Panicln(args ...interface{}) {
s.logln(PanicLevel, args, nil)
}
-// Fatalln uses fmt.Sprintln to construct and log a message, then calls os.Exit.
+// Fatalln logs a message at [FatalLevel] and calls os.Exit.
+// Spaces are always added between arguments.
func (s *SugaredLogger) Fatalln(args ...interface{}) {
s.logln(FatalLevel, args, nil)
}
diff --git a/vendor/go.uber.org/zap/writer.go b/vendor/go.uber.org/zap/writer.go
index f08728e1e..06768c679 100644
--- a/vendor/go.uber.org/zap/writer.go
+++ b/vendor/go.uber.org/zap/writer.go
@@ -48,21 +48,21 @@ import (
// os.Stdout and os.Stderr. When specified without a scheme, relative file
// paths also work.
func Open(paths ...string) (zapcore.WriteSyncer, func(), error) {
- writers, close, err := open(paths)
+ writers, closeAll, err := open(paths)
if err != nil {
return nil, nil, err
}
writer := CombineWriteSyncers(writers...)
- return writer, close, nil
+ return writer, closeAll, nil
}
func open(paths []string) ([]zapcore.WriteSyncer, func(), error) {
writers := make([]zapcore.WriteSyncer, 0, len(paths))
closers := make([]io.Closer, 0, len(paths))
- close := func() {
+ closeAll := func() {
for _, c := range closers {
- c.Close()
+ _ = c.Close()
}
}
@@ -77,11 +77,11 @@ func open(paths []string) ([]zapcore.WriteSyncer, func(), error) {
closers = append(closers, sink)
}
if openErr != nil {
- close()
+ closeAll()
return nil, nil, openErr
}
- return writers, close, nil
+ return writers, closeAll, nil
}
// CombineWriteSyncers is a utility that combines multiple WriteSyncers into a
diff --git a/vendor/go.uber.org/zap/zapcore/console_encoder.go b/vendor/go.uber.org/zap/zapcore/console_encoder.go
index 1aa5dc364..8ca0bfaf5 100644
--- a/vendor/go.uber.org/zap/zapcore/console_encoder.go
+++ b/vendor/go.uber.org/zap/zapcore/console_encoder.go
@@ -22,20 +22,20 @@ package zapcore
import (
"fmt"
- "sync"
"go.uber.org/zap/buffer"
"go.uber.org/zap/internal/bufferpool"
+ "go.uber.org/zap/internal/pool"
)
-var _sliceEncoderPool = sync.Pool{
- New: func() interface{} {
- return &sliceArrayEncoder{elems: make([]interface{}, 0, 2)}
- },
-}
+var _sliceEncoderPool = pool.New(func() *sliceArrayEncoder {
+ return &sliceArrayEncoder{
+ elems: make([]interface{}, 0, 2),
+ }
+})
func getSliceEncoder() *sliceArrayEncoder {
- return _sliceEncoderPool.Get().(*sliceArrayEncoder)
+ return _sliceEncoderPool.Get()
}
func putSliceEncoder(e *sliceArrayEncoder) {
diff --git a/vendor/go.uber.org/zap/zapcore/core.go b/vendor/go.uber.org/zap/zapcore/core.go
index 9dfd64051..776e93f6f 100644
--- a/vendor/go.uber.org/zap/zapcore/core.go
+++ b/vendor/go.uber.org/zap/zapcore/core.go
@@ -102,9 +102,9 @@ func (c *ioCore) Write(ent Entry, fields []Field) error {
return err
}
if ent.Level > ErrorLevel {
- // Since we may be crashing the program, sync the output. Ignore Sync
- // errors, pending a clean solution to issue #370.
- c.Sync()
+ // Since we may be crashing the program, sync the output.
+ // Ignore Sync errors, pending a clean solution to issue #370.
+ _ = c.Sync()
}
return nil
}
diff --git a/vendor/go.uber.org/zap/zapcore/entry.go b/vendor/go.uber.org/zap/zapcore/entry.go
index 9d326e95e..459a5d7ce 100644
--- a/vendor/go.uber.org/zap/zapcore/entry.go
+++ b/vendor/go.uber.org/zap/zapcore/entry.go
@@ -24,25 +24,23 @@ import (
"fmt"
"runtime"
"strings"
- "sync"
"time"
"go.uber.org/multierr"
"go.uber.org/zap/internal/bufferpool"
"go.uber.org/zap/internal/exit"
+ "go.uber.org/zap/internal/pool"
)
-var (
- _cePool = sync.Pool{New: func() interface{} {
- // Pre-allocate some space for cores.
- return &CheckedEntry{
- cores: make([]Core, 4),
- }
- }}
-)
+var _cePool = pool.New(func() *CheckedEntry {
+ // Pre-allocate some space for cores.
+ return &CheckedEntry{
+ cores: make([]Core, 4),
+ }
+})
func getCheckedEntry() *CheckedEntry {
- ce := _cePool.Get().(*CheckedEntry)
+ ce := _cePool.Get()
ce.reset()
return ce
}
@@ -244,7 +242,7 @@ func (ce *CheckedEntry) Write(fields ...Field) {
// CheckedEntry is being used after it was returned to the pool,
// the message may be an amalgamation from multiple call sites.
fmt.Fprintf(ce.ErrorOutput, "%v Unsafe CheckedEntry re-use near Entry %+v.\n", ce.Time, ce.Entry)
- ce.ErrorOutput.Sync()
+ _ = ce.ErrorOutput.Sync() // ignore error
}
return
}
@@ -256,7 +254,7 @@ func (ce *CheckedEntry) Write(fields ...Field) {
}
if err != nil && ce.ErrorOutput != nil {
fmt.Fprintf(ce.ErrorOutput, "%v write error: %v\n", ce.Time, err)
- ce.ErrorOutput.Sync()
+ _ = ce.ErrorOutput.Sync() // ignore error
}
hook := ce.after
diff --git a/vendor/go.uber.org/zap/zapcore/error.go b/vendor/go.uber.org/zap/zapcore/error.go
index 06359907a..c40df1326 100644
--- a/vendor/go.uber.org/zap/zapcore/error.go
+++ b/vendor/go.uber.org/zap/zapcore/error.go
@@ -23,7 +23,8 @@ package zapcore
import (
"fmt"
"reflect"
- "sync"
+
+ "go.uber.org/zap/internal/pool"
)
// Encodes the given error into fields of an object. A field with the given
@@ -97,15 +98,18 @@ func (errs errArray) MarshalLogArray(arr ArrayEncoder) error {
}
el := newErrArrayElem(errs[i])
- arr.AppendObject(el)
+ err := arr.AppendObject(el)
el.Free()
+ if err != nil {
+ return err
+ }
}
return nil
}
-var _errArrayElemPool = sync.Pool{New: func() interface{} {
+var _errArrayElemPool = pool.New(func() *errArrayElem {
return &errArrayElem{}
-}}
+})
// Encodes any error into a {"error": ...} re-using the same errors logic.
//
@@ -113,7 +117,7 @@ var _errArrayElemPool = sync.Pool{New: func() interface{} {
type errArrayElem struct{ err error }
func newErrArrayElem(err error) *errArrayElem {
- e := _errArrayElemPool.Get().(*errArrayElem)
+ e := _errArrayElemPool.Get()
e.err = err
return e
}
diff --git a/vendor/go.uber.org/zap/zapcore/json_encoder.go b/vendor/go.uber.org/zap/zapcore/json_encoder.go
index 3921c5cd3..c8ab86979 100644
--- a/vendor/go.uber.org/zap/zapcore/json_encoder.go
+++ b/vendor/go.uber.org/zap/zapcore/json_encoder.go
@@ -23,24 +23,20 @@ package zapcore
import (
"encoding/base64"
"math"
- "sync"
"time"
"unicode/utf8"
"go.uber.org/zap/buffer"
"go.uber.org/zap/internal/bufferpool"
+ "go.uber.org/zap/internal/pool"
)
// For JSON-escaping; see jsonEncoder.safeAddString below.
const _hex = "0123456789abcdef"
-var _jsonPool = sync.Pool{New: func() interface{} {
+var _jsonPool = pool.New(func() *jsonEncoder {
return &jsonEncoder{}
-}}
-
-func getJSONEncoder() *jsonEncoder {
- return _jsonPool.Get().(*jsonEncoder)
-}
+})
func putJSONEncoder(enc *jsonEncoder) {
if enc.reflectBuf != nil {
@@ -354,7 +350,7 @@ func (enc *jsonEncoder) Clone() Encoder {
}
func (enc *jsonEncoder) clone() *jsonEncoder {
- clone := getJSONEncoder()
+ clone := _jsonPool.Get()
clone.EncoderConfig = enc.EncoderConfig
clone.spaced = enc.spaced
clone.openNamespaces = enc.openNamespaces
@@ -490,73 +486,98 @@ func (enc *jsonEncoder) appendFloat(val float64, bitSize int) {
// Unlike the standard library's encoder, it doesn't attempt to protect the
// user from browser vulnerabilities or JSONP-related problems.
func (enc *jsonEncoder) safeAddString(s string) {
- for i := 0; i < len(s); {
- if enc.tryAddRuneSelf(s[i]) {
- i++
- continue
- }
- r, size := utf8.DecodeRuneInString(s[i:])
- if enc.tryAddRuneError(r, size) {
- i++
- continue
- }
- enc.buf.AppendString(s[i : i+size])
- i += size
- }
+ safeAppendStringLike(
+ (*buffer.Buffer).AppendString,
+ utf8.DecodeRuneInString,
+ enc.buf,
+ s,
+ )
}
// safeAddByteString is no-alloc equivalent of safeAddString(string(s)) for s []byte.
func (enc *jsonEncoder) safeAddByteString(s []byte) {
+ safeAppendStringLike(
+ (*buffer.Buffer).AppendBytes,
+ utf8.DecodeRune,
+ enc.buf,
+ s,
+ )
+}
+
+// safeAppendStringLike is a generic implementation of safeAddString and safeAddByteString.
+// It appends a string or byte slice to the buffer, escaping all special characters.
+func safeAppendStringLike[S []byte | string](
+ // appendTo appends this string-like object to the buffer.
+ appendTo func(*buffer.Buffer, S),
+ // decodeRune decodes the next rune from the string-like object
+ // and returns its value and width in bytes.
+ decodeRune func(S) (rune, int),
+ buf *buffer.Buffer,
+ s S,
+) {
+ // The encoding logic below works by skipping over characters
+ // that can be safely copied as-is,
+ // until a character is found that needs special handling.
+ // At that point, we copy everything we've seen so far,
+ // and then handle that special character.
+ //
+ // last is the index of the last byte that was copied to the buffer.
+ last := 0
for i := 0; i < len(s); {
- if enc.tryAddRuneSelf(s[i]) {
+ if s[i] >= utf8.RuneSelf {
+ // Character >= RuneSelf may be part of a multi-byte rune.
+ // They need to be decoded before we can decide how to handle them.
+ r, size := decodeRune(s[i:])
+ if r != utf8.RuneError || size != 1 {
+ // No special handling required.
+ // Skip over this rune and continue.
+ i += size
+ continue
+ }
+
+ // Invalid UTF-8 sequence.
+ // Replace it with the Unicode replacement character.
+ appendTo(buf, s[last:i])
+ buf.AppendString(`\ufffd`)
+
i++
- continue
- }
- r, size := utf8.DecodeRune(s[i:])
- if enc.tryAddRuneError(r, size) {
+ last = i
+ } else {
+ // Character < RuneSelf is a single-byte UTF-8 rune.
+ if s[i] >= 0x20 && s[i] != '\\' && s[i] != '"' {
+ // No escaping necessary.
+ // Skip over this character and continue.
+ i++
+ continue
+ }
+
+ // This character needs to be escaped.
+ appendTo(buf, s[last:i])
+ switch s[i] {
+ case '\\', '"':
+ buf.AppendByte('\\')
+ buf.AppendByte(s[i])
+ case '\n':
+ buf.AppendByte('\\')
+ buf.AppendByte('n')
+ case '\r':
+ buf.AppendByte('\\')
+ buf.AppendByte('r')
+ case '\t':
+ buf.AppendByte('\\')
+ buf.AppendByte('t')
+ default:
+ // Encode bytes < 0x20, except for the escape sequences above.
+ buf.AppendString(`\u00`)
+ buf.AppendByte(_hex[s[i]>>4])
+ buf.AppendByte(_hex[s[i]&0xF])
+ }
+
i++
- continue
+ last = i
}
- enc.buf.Write(s[i : i+size])
- i += size
- }
-}
-
-// tryAddRuneSelf appends b if it is valid UTF-8 character represented in a single byte.
-func (enc *jsonEncoder) tryAddRuneSelf(b byte) bool {
- if b >= utf8.RuneSelf {
- return false
- }
- if 0x20 <= b && b != '\\' && b != '"' {
- enc.buf.AppendByte(b)
- return true
- }
- switch b {
- case '\\', '"':
- enc.buf.AppendByte('\\')
- enc.buf.AppendByte(b)
- case '\n':
- enc.buf.AppendByte('\\')
- enc.buf.AppendByte('n')
- case '\r':
- enc.buf.AppendByte('\\')
- enc.buf.AppendByte('r')
- case '\t':
- enc.buf.AppendByte('\\')
- enc.buf.AppendByte('t')
- default:
- // Encode bytes < 0x20, except for the escape sequences above.
- enc.buf.AppendString(`\u00`)
- enc.buf.AppendByte(_hex[b>>4])
- enc.buf.AppendByte(_hex[b&0xF])
}
- return true
-}
-func (enc *jsonEncoder) tryAddRuneError(r rune, size int) bool {
- if r == utf8.RuneError && size == 1 {
- enc.buf.AppendString(`\ufffd`)
- return true
- }
- return false
+ // add remaining
+ appendTo(buf, s[last:])
}
diff --git a/vendor/go.uber.org/atomic/bool_ext.go b/vendor/go.uber.org/zap/zapcore/lazy_with.go
similarity index 60%
rename from vendor/go.uber.org/atomic/bool_ext.go
rename to vendor/go.uber.org/zap/zapcore/lazy_with.go
index c7bf7a827..05288d6a8 100644
--- a/vendor/go.uber.org/atomic/bool_ext.go
+++ b/vendor/go.uber.org/zap/zapcore/lazy_with.go
@@ -1,4 +1,4 @@
-// Copyright (c) 2020 Uber Technologies, Inc.
+// Copyright (c) 2023 Uber Technologies, Inc.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
@@ -18,36 +18,37 @@
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
-package atomic
+package zapcore
-import (
- "strconv"
-)
+import "sync"
-//go:generate bin/gen-atomicwrapper -name=Bool -type=bool -wrapped=Uint32 -pack=boolToInt -unpack=truthy -cas -swap -json -file=bool.go
-
-func truthy(n uint32) bool {
- return n == 1
+type lazyWithCore struct {
+ Core
+ sync.Once
+ fields []Field
}
-func boolToInt(b bool) uint32 {
- if b {
- return 1
+// NewLazyWith wraps a Core with a "lazy" Core that will only encode fields if
+// the logger is written to (or is further chained in a lon-lazy manner).
+func NewLazyWith(core Core, fields []Field) Core {
+ return &lazyWithCore{
+ Core: core,
+ fields: fields,
}
- return 0
}
-// Toggle atomically negates the Boolean and returns the previous value.
-func (b *Bool) Toggle() bool {
- for {
- old := b.Load()
- if b.CAS(old, !old) {
- return old
- }
- }
+func (d *lazyWithCore) initOnce() {
+ d.Once.Do(func() {
+ d.Core = d.Core.With(d.fields)
+ })
+}
+
+func (d *lazyWithCore) With(fields []Field) Core {
+ d.initOnce()
+ return d.Core.With(fields)
}
-// String encodes the wrapped value as a string.
-func (b *Bool) String() string {
- return strconv.FormatBool(b.Load())
+func (d *lazyWithCore) Check(e Entry, ce *CheckedEntry) *CheckedEntry {
+ d.initOnce()
+ return d.Core.Check(e, ce)
}
diff --git a/vendor/go.uber.org/zap/zapcore/sampler.go b/vendor/go.uber.org/zap/zapcore/sampler.go
index dc518055a..b7c093a4f 100644
--- a/vendor/go.uber.org/zap/zapcore/sampler.go
+++ b/vendor/go.uber.org/zap/zapcore/sampler.go
@@ -21,9 +21,8 @@
package zapcore
import (
+ "sync/atomic"
"time"
-
- "go.uber.org/atomic"
)
const (
@@ -66,16 +65,16 @@ func (c *counter) IncCheckReset(t time.Time, tick time.Duration) uint64 {
tn := t.UnixNano()
resetAfter := c.resetAt.Load()
if resetAfter > tn {
- return c.counter.Inc()
+ return c.counter.Add(1)
}
c.counter.Store(1)
newResetAfter := tn + tick.Nanoseconds()
- if !c.resetAt.CAS(resetAfter, newResetAfter) {
+ if !c.resetAt.CompareAndSwap(resetAfter, newResetAfter) {
// We raced with another goroutine trying to reset, and it also reset
// the counter to 1, so we need to reincrement the counter.
- return c.counter.Inc()
+ return c.counter.Add(1)
}
return 1
diff --git a/vendor/go.uber.org/zap/zapgrpc/zapgrpc.go b/vendor/go.uber.org/zap/zapgrpc/zapgrpc.go
index 71ca30b51..6823773b7 100644
--- a/vendor/go.uber.org/zap/zapgrpc/zapgrpc.go
+++ b/vendor/go.uber.org/zap/zapgrpc/zapgrpc.go
@@ -30,10 +30,10 @@ import (
// See https://github.com/grpc/grpc-go/blob/v1.35.0/grpclog/loggerv2.go#L77-L86
const (
- grpcLvlInfo = 0
- grpcLvlWarn = 1
- grpcLvlError = 2
- grpcLvlFatal = 3
+ grpcLvlInfo int = iota
+ grpcLvlWarn
+ grpcLvlError
+ grpcLvlFatal
)
var (
diff --git a/vendor/golang.org/x/crypto/hkdf/hkdf.go b/vendor/golang.org/x/crypto/hkdf/hkdf.go
new file mode 100644
index 000000000..f4ded5fee
--- /dev/null
+++ b/vendor/golang.org/x/crypto/hkdf/hkdf.go
@@ -0,0 +1,95 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package hkdf implements the HMAC-based Extract-and-Expand Key Derivation
+// Function (HKDF) as defined in RFC 5869.
+//
+// HKDF is a cryptographic key derivation function (KDF) with the goal of
+// expanding limited input keying material into one or more cryptographically
+// strong secret keys.
+package hkdf // import "golang.org/x/crypto/hkdf"
+
+import (
+ "crypto/hmac"
+ "errors"
+ "hash"
+ "io"
+)
+
+// Extract generates a pseudorandom key for use with Expand from an input secret
+// and an optional independent salt.
+//
+// Only use this function if you need to reuse the extracted key with multiple
+// Expand invocations and different context values. Most common scenarios,
+// including the generation of multiple keys, should use New instead.
+func Extract(hash func() hash.Hash, secret, salt []byte) []byte {
+ if salt == nil {
+ salt = make([]byte, hash().Size())
+ }
+ extractor := hmac.New(hash, salt)
+ extractor.Write(secret)
+ return extractor.Sum(nil)
+}
+
+type hkdf struct {
+ expander hash.Hash
+ size int
+
+ info []byte
+ counter byte
+
+ prev []byte
+ buf []byte
+}
+
+func (f *hkdf) Read(p []byte) (int, error) {
+ // Check whether enough data can be generated
+ need := len(p)
+ remains := len(f.buf) + int(255-f.counter+1)*f.size
+ if remains < need {
+ return 0, errors.New("hkdf: entropy limit reached")
+ }
+ // Read any leftover from the buffer
+ n := copy(p, f.buf)
+ p = p[n:]
+
+ // Fill the rest of the buffer
+ for len(p) > 0 {
+ if f.counter > 1 {
+ f.expander.Reset()
+ }
+ f.expander.Write(f.prev)
+ f.expander.Write(f.info)
+ f.expander.Write([]byte{f.counter})
+ f.prev = f.expander.Sum(f.prev[:0])
+ f.counter++
+
+ // Copy the new batch into p
+ f.buf = f.prev
+ n = copy(p, f.buf)
+ p = p[n:]
+ }
+ // Save leftovers for next run
+ f.buf = f.buf[n:]
+
+ return need, nil
+}
+
+// Expand returns a Reader, from which keys can be read, using the given
+// pseudorandom key and optional context info, skipping the extraction step.
+//
+// The pseudorandomKey should have been generated by Extract, or be a uniformly
+// random or pseudorandom cryptographically strong key. See RFC 5869, Section
+// 3.3. Most common scenarios will want to use New instead.
+func Expand(hash func() hash.Hash, pseudorandomKey, info []byte) io.Reader {
+ expander := hmac.New(hash, pseudorandomKey)
+ return &hkdf{expander, expander.Size(), info, 1, nil, nil}
+}
+
+// New returns a Reader, from which keys can be read, using the given hash,
+// secret, salt and context info. Salt and info can be nil.
+func New(hash func() hash.Hash, secret, salt, info []byte) io.Reader {
+ prk := Extract(hash, secret, salt)
+ return Expand(hash, prk, info)
+}
diff --git a/vendor/golang.org/x/exp/LICENSE b/vendor/golang.org/x/exp/LICENSE
new file mode 100644
index 000000000..6a66aea5e
--- /dev/null
+++ b/vendor/golang.org/x/exp/LICENSE
@@ -0,0 +1,27 @@
+Copyright (c) 2009 The Go Authors. All rights reserved.
+
+Redistribution and use in source and binary forms, with or without
+modification, are permitted provided that the following conditions are
+met:
+
+ * Redistributions of source code must retain the above copyright
+notice, this list of conditions and the following disclaimer.
+ * Redistributions in binary form must reproduce the above
+copyright notice, this list of conditions and the following disclaimer
+in the documentation and/or other materials provided with the
+distribution.
+ * Neither the name of Google Inc. nor the names of its
+contributors may be used to endorse or promote products derived from
+this software without specific prior written permission.
+
+THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
+"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
+LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
+A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
+OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
+LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
+DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
+THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
+OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/exp/PATENTS b/vendor/golang.org/x/exp/PATENTS
new file mode 100644
index 000000000..733099041
--- /dev/null
+++ b/vendor/golang.org/x/exp/PATENTS
@@ -0,0 +1,22 @@
+Additional IP Rights Grant (Patents)
+
+"This implementation" means the copyrightable works distributed by
+Google as part of the Go project.
+
+Google hereby grants to You a perpetual, worldwide, non-exclusive,
+no-charge, royalty-free, irrevocable (except as stated in this section)
+patent license to make, have made, use, offer to sell, sell, import,
+transfer and otherwise run, modify and propagate the contents of this
+implementation of Go, where such license applies only to those patent
+claims, both currently owned or controlled by Google and acquired in
+the future, licensable by Google that are necessarily infringed by this
+implementation of Go. This grant does not include claims that would be
+infringed only as a consequence of further modification of this
+implementation. If you or your agent or exclusive licensee institute or
+order or agree to the institution of patent litigation against any
+entity (including a cross-claim or counterclaim in a lawsuit) alleging
+that this implementation of Go or any code incorporated within this
+implementation of Go constitutes direct or contributory patent
+infringement, or inducement of patent infringement, then any patent
+rights granted to you under this License for this implementation of Go
+shall terminate as of the date such litigation is filed.
diff --git a/vendor/golang.org/x/exp/constraints/constraints.go b/vendor/golang.org/x/exp/constraints/constraints.go
new file mode 100644
index 000000000..2c033dff4
--- /dev/null
+++ b/vendor/golang.org/x/exp/constraints/constraints.go
@@ -0,0 +1,50 @@
+// Copyright 2021 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package constraints defines a set of useful constraints to be used
+// with type parameters.
+package constraints
+
+// Signed is a constraint that permits any signed integer type.
+// If future releases of Go add new predeclared signed integer types,
+// this constraint will be modified to include them.
+type Signed interface {
+ ~int | ~int8 | ~int16 | ~int32 | ~int64
+}
+
+// Unsigned is a constraint that permits any unsigned integer type.
+// If future releases of Go add new predeclared unsigned integer types,
+// this constraint will be modified to include them.
+type Unsigned interface {
+ ~uint | ~uint8 | ~uint16 | ~uint32 | ~uint64 | ~uintptr
+}
+
+// Integer is a constraint that permits any integer type.
+// If future releases of Go add new predeclared integer types,
+// this constraint will be modified to include them.
+type Integer interface {
+ Signed | Unsigned
+}
+
+// Float is a constraint that permits any floating-point type.
+// If future releases of Go add new predeclared floating-point types,
+// this constraint will be modified to include them.
+type Float interface {
+ ~float32 | ~float64
+}
+
+// Complex is a constraint that permits any complex numeric type.
+// If future releases of Go add new predeclared complex numeric types,
+// this constraint will be modified to include them.
+type Complex interface {
+ ~complex64 | ~complex128
+}
+
+// Ordered is a constraint that permits any ordered type: any type
+// that supports the operators < <= >= >.
+// If future releases of Go add new ordered types,
+// this constraint will be modified to include them.
+type Ordered interface {
+ Integer | Float | ~string
+}
diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go
new file mode 100644
index 000000000..8a237c5d6
--- /dev/null
+++ b/vendor/golang.org/x/exp/slices/slices.go
@@ -0,0 +1,218 @@
+// Copyright 2021 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package slices defines various functions useful with slices of any type.
+// Unless otherwise specified, these functions all apply to the elements
+// of a slice at index 0 <= i < len(s).
+//
+// Note that the less function in IsSortedFunc, SortFunc, SortStableFunc requires a
+// strict weak ordering (https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings),
+// or the sorting may fail to sort correctly. A common case is when sorting slices of
+// floating-point numbers containing NaN values.
+package slices
+
+import "golang.org/x/exp/constraints"
+
+// Equal reports whether two slices are equal: the same length and all
+// elements equal. If the lengths are different, Equal returns false.
+// Otherwise, the elements are compared in increasing index order, and the
+// comparison stops at the first unequal pair.
+// Floating point NaNs are not considered equal.
+func Equal[E comparable](s1, s2 []E) bool {
+ if len(s1) != len(s2) {
+ return false
+ }
+ for i := range s1 {
+ if s1[i] != s2[i] {
+ return false
+ }
+ }
+ return true
+}
+
+// EqualFunc reports whether two slices are equal using a comparison
+// function on each pair of elements. If the lengths are different,
+// EqualFunc returns false. Otherwise, the elements are compared in
+// increasing index order, and the comparison stops at the first index
+// for which eq returns false.
+func EqualFunc[E1, E2 any](s1 []E1, s2 []E2, eq func(E1, E2) bool) bool {
+ if len(s1) != len(s2) {
+ return false
+ }
+ for i, v1 := range s1 {
+ v2 := s2[i]
+ if !eq(v1, v2) {
+ return false
+ }
+ }
+ return true
+}
+
+// Compare compares the elements of s1 and s2.
+// The elements are compared sequentially, starting at index 0,
+// until one element is not equal to the other.
+// The result of comparing the first non-matching elements is returned.
+// If both slices are equal until one of them ends, the shorter slice is
+// considered less than the longer one.
+// The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2.
+// Comparisons involving floating point NaNs are ignored.
+func Compare[E constraints.Ordered](s1, s2 []E) int {
+ s2len := len(s2)
+ for i, v1 := range s1 {
+ if i >= s2len {
+ return +1
+ }
+ v2 := s2[i]
+ switch {
+ case v1 < v2:
+ return -1
+ case v1 > v2:
+ return +1
+ }
+ }
+ if len(s1) < s2len {
+ return -1
+ }
+ return 0
+}
+
+// CompareFunc is like Compare but uses a comparison function
+// on each pair of elements. The elements are compared in increasing
+// index order, and the comparisons stop after the first time cmp
+// returns non-zero.
+// The result is the first non-zero result of cmp; if cmp always
+// returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2),
+// and +1 if len(s1) > len(s2).
+func CompareFunc[E1, E2 any](s1 []E1, s2 []E2, cmp func(E1, E2) int) int {
+ s2len := len(s2)
+ for i, v1 := range s1 {
+ if i >= s2len {
+ return +1
+ }
+ v2 := s2[i]
+ if c := cmp(v1, v2); c != 0 {
+ return c
+ }
+ }
+ if len(s1) < s2len {
+ return -1
+ }
+ return 0
+}
+
+// Index returns the index of the first occurrence of v in s,
+// or -1 if not present.
+func Index[E comparable](s []E, v E) int {
+ for i, vs := range s {
+ if v == vs {
+ return i
+ }
+ }
+ return -1
+}
+
+// IndexFunc returns the first index i satisfying f(s[i]),
+// or -1 if none do.
+func IndexFunc[E any](s []E, f func(E) bool) int {
+ for i, v := range s {
+ if f(v) {
+ return i
+ }
+ }
+ return -1
+}
+
+// Contains reports whether v is present in s.
+func Contains[E comparable](s []E, v E) bool {
+ return Index(s, v) >= 0
+}
+
+// Insert inserts the values v... into s at index i,
+// returning the modified slice.
+// In the returned slice r, r[i] == v[0].
+// Insert panics if i is out of range.
+// This function is O(len(s) + len(v)).
+func Insert[S ~[]E, E any](s S, i int, v ...E) S {
+ tot := len(s) + len(v)
+ if tot <= cap(s) {
+ s2 := s[:tot]
+ copy(s2[i+len(v):], s[i:])
+ copy(s2[i:], v)
+ return s2
+ }
+ s2 := make(S, tot)
+ copy(s2, s[:i])
+ copy(s2[i:], v)
+ copy(s2[i+len(v):], s[i:])
+ return s2
+}
+
+// Delete removes the elements s[i:j] from s, returning the modified slice.
+// Delete panics if s[i:j] is not a valid slice of s.
+// Delete modifies the contents of the slice s; it does not create a new slice.
+// Delete is O(len(s)-(j-i)), so if many items must be deleted, it is better to
+// make a single call deleting them all together than to delete one at a time.
+func Delete[S ~[]E, E any](s S, i, j int) S {
+ return append(s[:i], s[j:]...)
+}
+
+// Clone returns a copy of the slice.
+// The elements are copied using assignment, so this is a shallow clone.
+func Clone[S ~[]E, E any](s S) S {
+ // Preserve nil in case it matters.
+ if s == nil {
+ return nil
+ }
+ return append(S([]E{}), s...)
+}
+
+// Compact replaces consecutive runs of equal elements with a single copy.
+// This is like the uniq command found on Unix.
+// Compact modifies the contents of the slice s; it does not create a new slice.
+func Compact[S ~[]E, E comparable](s S) S {
+ if len(s) == 0 {
+ return s
+ }
+ i := 1
+ last := s[0]
+ for _, v := range s[1:] {
+ if v != last {
+ s[i] = v
+ i++
+ last = v
+ }
+ }
+ return s[:i]
+}
+
+// CompactFunc is like Compact but uses a comparison function.
+func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S {
+ if len(s) == 0 {
+ return s
+ }
+ i := 1
+ last := s[0]
+ for _, v := range s[1:] {
+ if !eq(v, last) {
+ s[i] = v
+ i++
+ last = v
+ }
+ }
+ return s[:i]
+}
+
+// Grow increases the slice's capacity, if necessary, to guarantee space for
+// another n elements. After Grow(n), at least n elements can be appended
+// to the slice without another allocation. Grow may modify elements of the
+// slice between the length and the capacity. If n is negative or too large to
+// allocate the memory, Grow panics.
+func Grow[S ~[]E, E any](s S, n int) S {
+ return append(s, make(S, n)...)[:len(s)]
+}
+
+// Clip removes unused capacity from the slice, returning s[:len(s):len(s)].
+func Clip[S ~[]E, E any](s S) S {
+ return s[:len(s):len(s)]
+}
diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go
new file mode 100644
index 000000000..c22e74bd1
--- /dev/null
+++ b/vendor/golang.org/x/exp/slices/sort.go
@@ -0,0 +1,127 @@
+// Copyright 2022 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package slices
+
+import (
+ "math/bits"
+
+ "golang.org/x/exp/constraints"
+)
+
+// Sort sorts a slice of any ordered type in ascending order.
+// Sort may fail to sort correctly when sorting slices of floating-point
+// numbers containing Not-a-number (NaN) values.
+// Use slices.SortFunc(x, func(a, b float64) bool {return a < b || (math.IsNaN(a) && !math.IsNaN(b))})
+// instead if the input may contain NaNs.
+func Sort[E constraints.Ordered](x []E) {
+ n := len(x)
+ pdqsortOrdered(x, 0, n, bits.Len(uint(n)))
+}
+
+// SortFunc sorts the slice x in ascending order as determined by the less function.
+// This sort is not guaranteed to be stable.
+//
+// SortFunc requires that less is a strict weak ordering.
+// See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings.
+func SortFunc[E any](x []E, less func(a, b E) bool) {
+ n := len(x)
+ pdqsortLessFunc(x, 0, n, bits.Len(uint(n)), less)
+}
+
+// SortStable sorts the slice x while keeping the original order of equal
+// elements, using less to compare elements.
+func SortStableFunc[E any](x []E, less func(a, b E) bool) {
+ stableLessFunc(x, len(x), less)
+}
+
+// IsSorted reports whether x is sorted in ascending order.
+func IsSorted[E constraints.Ordered](x []E) bool {
+ for i := len(x) - 1; i > 0; i-- {
+ if x[i] < x[i-1] {
+ return false
+ }
+ }
+ return true
+}
+
+// IsSortedFunc reports whether x is sorted in ascending order, with less as the
+// comparison function.
+func IsSortedFunc[E any](x []E, less func(a, b E) bool) bool {
+ for i := len(x) - 1; i > 0; i-- {
+ if less(x[i], x[i-1]) {
+ return false
+ }
+ }
+ return true
+}
+
+// BinarySearch searches for target in a sorted slice and returns the position
+// where target is found, or the position where target would appear in the
+// sort order; it also returns a bool saying whether the target is really found
+// in the slice. The slice must be sorted in increasing order.
+func BinarySearch[E constraints.Ordered](x []E, target E) (int, bool) {
+ // search returns the leftmost position where f returns true, or len(x) if f
+ // returns false for all x. This is the insertion position for target in x,
+ // and could point to an element that's either == target or not.
+ pos := search(len(x), func(i int) bool { return x[i] >= target })
+ if pos >= len(x) || x[pos] != target {
+ return pos, false
+ } else {
+ return pos, true
+ }
+}
+
+// BinarySearchFunc works like BinarySearch, but uses a custom comparison
+// function. The slice must be sorted in increasing order, where "increasing" is
+// defined by cmp. cmp(a, b) is expected to return an integer comparing the two
+// parameters: 0 if a == b, a negative number if a < b and a positive number if
+// a > b.
+func BinarySearchFunc[E any](x []E, target E, cmp func(E, E) int) (int, bool) {
+ pos := search(len(x), func(i int) bool { return cmp(x[i], target) >= 0 })
+ if pos >= len(x) || cmp(x[pos], target) != 0 {
+ return pos, false
+ } else {
+ return pos, true
+ }
+}
+
+func search(n int, f func(int) bool) int {
+ // Define f(-1) == false and f(n) == true.
+ // Invariant: f(i-1) == false, f(j) == true.
+ i, j := 0, n
+ for i < j {
+ h := int(uint(i+j) >> 1) // avoid overflow when computing h
+ // i ≤ h < j
+ if !f(h) {
+ i = h + 1 // preserves f(i-1) == false
+ } else {
+ j = h // preserves f(j) == true
+ }
+ }
+ // i == j, f(i-1) == false, and f(j) (= f(i)) == true => answer is i.
+ return i
+}
+
+type sortedHint int // hint for pdqsort when choosing the pivot
+
+const (
+ unknownHint sortedHint = iota
+ increasingHint
+ decreasingHint
+)
+
+// xorshift paper: https://www.jstatsoft.org/article/view/v008i14/xorshift.pdf
+type xorshift uint64
+
+func (r *xorshift) Next() uint64 {
+ *r ^= *r << 13
+ *r ^= *r >> 17
+ *r ^= *r << 5
+ return uint64(*r)
+}
+
+func nextPowerOfTwo(length int) uint {
+ return 1 << bits.Len(uint(length))
+}
diff --git a/vendor/golang.org/x/exp/slices/zsortfunc.go b/vendor/golang.org/x/exp/slices/zsortfunc.go
new file mode 100644
index 000000000..2a632476c
--- /dev/null
+++ b/vendor/golang.org/x/exp/slices/zsortfunc.go
@@ -0,0 +1,479 @@
+// Code generated by gen_sort_variants.go; DO NOT EDIT.
+
+// Copyright 2022 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package slices
+
+// insertionSortLessFunc sorts data[a:b] using insertion sort.
+func insertionSortLessFunc[E any](data []E, a, b int, less func(a, b E) bool) {
+ for i := a + 1; i < b; i++ {
+ for j := i; j > a && less(data[j], data[j-1]); j-- {
+ data[j], data[j-1] = data[j-1], data[j]
+ }
+ }
+}
+
+// siftDownLessFunc implements the heap property on data[lo:hi].
+// first is an offset into the array where the root of the heap lies.
+func siftDownLessFunc[E any](data []E, lo, hi, first int, less func(a, b E) bool) {
+ root := lo
+ for {
+ child := 2*root + 1
+ if child >= hi {
+ break
+ }
+ if child+1 < hi && less(data[first+child], data[first+child+1]) {
+ child++
+ }
+ if !less(data[first+root], data[first+child]) {
+ return
+ }
+ data[first+root], data[first+child] = data[first+child], data[first+root]
+ root = child
+ }
+}
+
+func heapSortLessFunc[E any](data []E, a, b int, less func(a, b E) bool) {
+ first := a
+ lo := 0
+ hi := b - a
+
+ // Build heap with greatest element at top.
+ for i := (hi - 1) / 2; i >= 0; i-- {
+ siftDownLessFunc(data, i, hi, first, less)
+ }
+
+ // Pop elements, largest first, into end of data.
+ for i := hi - 1; i >= 0; i-- {
+ data[first], data[first+i] = data[first+i], data[first]
+ siftDownLessFunc(data, lo, i, first, less)
+ }
+}
+
+// pdqsortLessFunc sorts data[a:b].
+// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort.
+// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf
+// C++ implementation: https://github.com/orlp/pdqsort
+// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/
+// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort.
+func pdqsortLessFunc[E any](data []E, a, b, limit int, less func(a, b E) bool) {
+ const maxInsertion = 12
+
+ var (
+ wasBalanced = true // whether the last partitioning was reasonably balanced
+ wasPartitioned = true // whether the slice was already partitioned
+ )
+
+ for {
+ length := b - a
+
+ if length <= maxInsertion {
+ insertionSortLessFunc(data, a, b, less)
+ return
+ }
+
+ // Fall back to heapsort if too many bad choices were made.
+ if limit == 0 {
+ heapSortLessFunc(data, a, b, less)
+ return
+ }
+
+ // If the last partitioning was imbalanced, we need to breaking patterns.
+ if !wasBalanced {
+ breakPatternsLessFunc(data, a, b, less)
+ limit--
+ }
+
+ pivot, hint := choosePivotLessFunc(data, a, b, less)
+ if hint == decreasingHint {
+ reverseRangeLessFunc(data, a, b, less)
+ // The chosen pivot was pivot-a elements after the start of the array.
+ // After reversing it is pivot-a elements before the end of the array.
+ // The idea came from Rust's implementation.
+ pivot = (b - 1) - (pivot - a)
+ hint = increasingHint
+ }
+
+ // The slice is likely already sorted.
+ if wasBalanced && wasPartitioned && hint == increasingHint {
+ if partialInsertionSortLessFunc(data, a, b, less) {
+ return
+ }
+ }
+
+ // Probably the slice contains many duplicate elements, partition the slice into
+ // elements equal to and elements greater than the pivot.
+ if a > 0 && !less(data[a-1], data[pivot]) {
+ mid := partitionEqualLessFunc(data, a, b, pivot, less)
+ a = mid
+ continue
+ }
+
+ mid, alreadyPartitioned := partitionLessFunc(data, a, b, pivot, less)
+ wasPartitioned = alreadyPartitioned
+
+ leftLen, rightLen := mid-a, b-mid
+ balanceThreshold := length / 8
+ if leftLen < rightLen {
+ wasBalanced = leftLen >= balanceThreshold
+ pdqsortLessFunc(data, a, mid, limit, less)
+ a = mid + 1
+ } else {
+ wasBalanced = rightLen >= balanceThreshold
+ pdqsortLessFunc(data, mid+1, b, limit, less)
+ b = mid
+ }
+ }
+}
+
+// partitionLessFunc does one quicksort partition.
+// Let p = data[pivot]
+// Moves elements in data[a:b] around, so that data[i]=p for inewpivot.
+// On return, data[newpivot] = p
+func partitionLessFunc[E any](data []E, a, b, pivot int, less func(a, b E) bool) (newpivot int, alreadyPartitioned bool) {
+ data[a], data[pivot] = data[pivot], data[a]
+ i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned
+
+ for i <= j && less(data[i], data[a]) {
+ i++
+ }
+ for i <= j && !less(data[j], data[a]) {
+ j--
+ }
+ if i > j {
+ data[j], data[a] = data[a], data[j]
+ return j, true
+ }
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+
+ for {
+ for i <= j && less(data[i], data[a]) {
+ i++
+ }
+ for i <= j && !less(data[j], data[a]) {
+ j--
+ }
+ if i > j {
+ break
+ }
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+ }
+ data[j], data[a] = data[a], data[j]
+ return j, false
+}
+
+// partitionEqualLessFunc partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot].
+// It assumed that data[a:b] does not contain elements smaller than the data[pivot].
+func partitionEqualLessFunc[E any](data []E, a, b, pivot int, less func(a, b E) bool) (newpivot int) {
+ data[a], data[pivot] = data[pivot], data[a]
+ i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned
+
+ for {
+ for i <= j && !less(data[a], data[i]) {
+ i++
+ }
+ for i <= j && less(data[a], data[j]) {
+ j--
+ }
+ if i > j {
+ break
+ }
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+ }
+ return i
+}
+
+// partialInsertionSortLessFunc partially sorts a slice, returns true if the slice is sorted at the end.
+func partialInsertionSortLessFunc[E any](data []E, a, b int, less func(a, b E) bool) bool {
+ const (
+ maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted
+ shortestShifting = 50 // don't shift any elements on short arrays
+ )
+ i := a + 1
+ for j := 0; j < maxSteps; j++ {
+ for i < b && !less(data[i], data[i-1]) {
+ i++
+ }
+
+ if i == b {
+ return true
+ }
+
+ if b-a < shortestShifting {
+ return false
+ }
+
+ data[i], data[i-1] = data[i-1], data[i]
+
+ // Shift the smaller one to the left.
+ if i-a >= 2 {
+ for j := i - 1; j >= 1; j-- {
+ if !less(data[j], data[j-1]) {
+ break
+ }
+ data[j], data[j-1] = data[j-1], data[j]
+ }
+ }
+ // Shift the greater one to the right.
+ if b-i >= 2 {
+ for j := i + 1; j < b; j++ {
+ if !less(data[j], data[j-1]) {
+ break
+ }
+ data[j], data[j-1] = data[j-1], data[j]
+ }
+ }
+ }
+ return false
+}
+
+// breakPatternsLessFunc scatters some elements around in an attempt to break some patterns
+// that might cause imbalanced partitions in quicksort.
+func breakPatternsLessFunc[E any](data []E, a, b int, less func(a, b E) bool) {
+ length := b - a
+ if length >= 8 {
+ random := xorshift(length)
+ modulus := nextPowerOfTwo(length)
+
+ for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ {
+ other := int(uint(random.Next()) & (modulus - 1))
+ if other >= length {
+ other -= length
+ }
+ data[idx], data[a+other] = data[a+other], data[idx]
+ }
+ }
+}
+
+// choosePivotLessFunc chooses a pivot in data[a:b].
+//
+// [0,8): chooses a static pivot.
+// [8,shortestNinther): uses the simple median-of-three method.
+// [shortestNinther,∞): uses the Tukey ninther method.
+func choosePivotLessFunc[E any](data []E, a, b int, less func(a, b E) bool) (pivot int, hint sortedHint) {
+ const (
+ shortestNinther = 50
+ maxSwaps = 4 * 3
+ )
+
+ l := b - a
+
+ var (
+ swaps int
+ i = a + l/4*1
+ j = a + l/4*2
+ k = a + l/4*3
+ )
+
+ if l >= 8 {
+ if l >= shortestNinther {
+ // Tukey ninther method, the idea came from Rust's implementation.
+ i = medianAdjacentLessFunc(data, i, &swaps, less)
+ j = medianAdjacentLessFunc(data, j, &swaps, less)
+ k = medianAdjacentLessFunc(data, k, &swaps, less)
+ }
+ // Find the median among i, j, k and stores it into j.
+ j = medianLessFunc(data, i, j, k, &swaps, less)
+ }
+
+ switch swaps {
+ case 0:
+ return j, increasingHint
+ case maxSwaps:
+ return j, decreasingHint
+ default:
+ return j, unknownHint
+ }
+}
+
+// order2LessFunc returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a.
+func order2LessFunc[E any](data []E, a, b int, swaps *int, less func(a, b E) bool) (int, int) {
+ if less(data[b], data[a]) {
+ *swaps++
+ return b, a
+ }
+ return a, b
+}
+
+// medianLessFunc returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c.
+func medianLessFunc[E any](data []E, a, b, c int, swaps *int, less func(a, b E) bool) int {
+ a, b = order2LessFunc(data, a, b, swaps, less)
+ b, c = order2LessFunc(data, b, c, swaps, less)
+ a, b = order2LessFunc(data, a, b, swaps, less)
+ return b
+}
+
+// medianAdjacentLessFunc finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a.
+func medianAdjacentLessFunc[E any](data []E, a int, swaps *int, less func(a, b E) bool) int {
+ return medianLessFunc(data, a-1, a, a+1, swaps, less)
+}
+
+func reverseRangeLessFunc[E any](data []E, a, b int, less func(a, b E) bool) {
+ i := a
+ j := b - 1
+ for i < j {
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+ }
+}
+
+func swapRangeLessFunc[E any](data []E, a, b, n int, less func(a, b E) bool) {
+ for i := 0; i < n; i++ {
+ data[a+i], data[b+i] = data[b+i], data[a+i]
+ }
+}
+
+func stableLessFunc[E any](data []E, n int, less func(a, b E) bool) {
+ blockSize := 20 // must be > 0
+ a, b := 0, blockSize
+ for b <= n {
+ insertionSortLessFunc(data, a, b, less)
+ a = b
+ b += blockSize
+ }
+ insertionSortLessFunc(data, a, n, less)
+
+ for blockSize < n {
+ a, b = 0, 2*blockSize
+ for b <= n {
+ symMergeLessFunc(data, a, a+blockSize, b, less)
+ a = b
+ b += 2 * blockSize
+ }
+ if m := a + blockSize; m < n {
+ symMergeLessFunc(data, a, m, n, less)
+ }
+ blockSize *= 2
+ }
+}
+
+// symMergeLessFunc merges the two sorted subsequences data[a:m] and data[m:b] using
+// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum
+// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz
+// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in
+// Computer Science, pages 714-723. Springer, 2004.
+//
+// Let M = m-a and N = b-n. Wolog M < N.
+// The recursion depth is bound by ceil(log(N+M)).
+// The algorithm needs O(M*log(N/M + 1)) calls to data.Less.
+// The algorithm needs O((M+N)*log(M)) calls to data.Swap.
+//
+// The paper gives O((M+N)*log(M)) as the number of assignments assuming a
+// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation
+// in the paper carries through for Swap operations, especially as the block
+// swapping rotate uses only O(M+N) Swaps.
+//
+// symMerge assumes non-degenerate arguments: a < m && m < b.
+// Having the caller check this condition eliminates many leaf recursion calls,
+// which improves performance.
+func symMergeLessFunc[E any](data []E, a, m, b int, less func(a, b E) bool) {
+ // Avoid unnecessary recursions of symMerge
+ // by direct insertion of data[a] into data[m:b]
+ // if data[a:m] only contains one element.
+ if m-a == 1 {
+ // Use binary search to find the lowest index i
+ // such that data[i] >= data[a] for m <= i < b.
+ // Exit the search loop with i == b in case no such index exists.
+ i := m
+ j := b
+ for i < j {
+ h := int(uint(i+j) >> 1)
+ if less(data[h], data[a]) {
+ i = h + 1
+ } else {
+ j = h
+ }
+ }
+ // Swap values until data[a] reaches the position before i.
+ for k := a; k < i-1; k++ {
+ data[k], data[k+1] = data[k+1], data[k]
+ }
+ return
+ }
+
+ // Avoid unnecessary recursions of symMerge
+ // by direct insertion of data[m] into data[a:m]
+ // if data[m:b] only contains one element.
+ if b-m == 1 {
+ // Use binary search to find the lowest index i
+ // such that data[i] > data[m] for a <= i < m.
+ // Exit the search loop with i == m in case no such index exists.
+ i := a
+ j := m
+ for i < j {
+ h := int(uint(i+j) >> 1)
+ if !less(data[m], data[h]) {
+ i = h + 1
+ } else {
+ j = h
+ }
+ }
+ // Swap values until data[m] reaches the position i.
+ for k := m; k > i; k-- {
+ data[k], data[k-1] = data[k-1], data[k]
+ }
+ return
+ }
+
+ mid := int(uint(a+b) >> 1)
+ n := mid + m
+ var start, r int
+ if m > mid {
+ start = n - b
+ r = mid
+ } else {
+ start = a
+ r = m
+ }
+ p := n - 1
+
+ for start < r {
+ c := int(uint(start+r) >> 1)
+ if !less(data[p-c], data[c]) {
+ start = c + 1
+ } else {
+ r = c
+ }
+ }
+
+ end := n - start
+ if start < m && m < end {
+ rotateLessFunc(data, start, m, end, less)
+ }
+ if a < start && start < mid {
+ symMergeLessFunc(data, a, start, mid, less)
+ }
+ if mid < end && end < b {
+ symMergeLessFunc(data, mid, end, b, less)
+ }
+}
+
+// rotateLessFunc rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data:
+// Data of the form 'x u v y' is changed to 'x v u y'.
+// rotate performs at most b-a many calls to data.Swap,
+// and it assumes non-degenerate arguments: a < m && m < b.
+func rotateLessFunc[E any](data []E, a, m, b int, less func(a, b E) bool) {
+ i := m - a
+ j := b - m
+
+ for i != j {
+ if i > j {
+ swapRangeLessFunc(data, m-i, m, j, less)
+ i -= j
+ } else {
+ swapRangeLessFunc(data, m-i, m+j-i, i, less)
+ j -= i
+ }
+ }
+ // i == j
+ swapRangeLessFunc(data, m-i, m, i, less)
+}
diff --git a/vendor/golang.org/x/exp/slices/zsortordered.go b/vendor/golang.org/x/exp/slices/zsortordered.go
new file mode 100644
index 000000000..efaa1c8b7
--- /dev/null
+++ b/vendor/golang.org/x/exp/slices/zsortordered.go
@@ -0,0 +1,481 @@
+// Code generated by gen_sort_variants.go; DO NOT EDIT.
+
+// Copyright 2022 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package slices
+
+import "golang.org/x/exp/constraints"
+
+// insertionSortOrdered sorts data[a:b] using insertion sort.
+func insertionSortOrdered[E constraints.Ordered](data []E, a, b int) {
+ for i := a + 1; i < b; i++ {
+ for j := i; j > a && (data[j] < data[j-1]); j-- {
+ data[j], data[j-1] = data[j-1], data[j]
+ }
+ }
+}
+
+// siftDownOrdered implements the heap property on data[lo:hi].
+// first is an offset into the array where the root of the heap lies.
+func siftDownOrdered[E constraints.Ordered](data []E, lo, hi, first int) {
+ root := lo
+ for {
+ child := 2*root + 1
+ if child >= hi {
+ break
+ }
+ if child+1 < hi && (data[first+child] < data[first+child+1]) {
+ child++
+ }
+ if !(data[first+root] < data[first+child]) {
+ return
+ }
+ data[first+root], data[first+child] = data[first+child], data[first+root]
+ root = child
+ }
+}
+
+func heapSortOrdered[E constraints.Ordered](data []E, a, b int) {
+ first := a
+ lo := 0
+ hi := b - a
+
+ // Build heap with greatest element at top.
+ for i := (hi - 1) / 2; i >= 0; i-- {
+ siftDownOrdered(data, i, hi, first)
+ }
+
+ // Pop elements, largest first, into end of data.
+ for i := hi - 1; i >= 0; i-- {
+ data[first], data[first+i] = data[first+i], data[first]
+ siftDownOrdered(data, lo, i, first)
+ }
+}
+
+// pdqsortOrdered sorts data[a:b].
+// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort.
+// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf
+// C++ implementation: https://github.com/orlp/pdqsort
+// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/
+// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort.
+func pdqsortOrdered[E constraints.Ordered](data []E, a, b, limit int) {
+ const maxInsertion = 12
+
+ var (
+ wasBalanced = true // whether the last partitioning was reasonably balanced
+ wasPartitioned = true // whether the slice was already partitioned
+ )
+
+ for {
+ length := b - a
+
+ if length <= maxInsertion {
+ insertionSortOrdered(data, a, b)
+ return
+ }
+
+ // Fall back to heapsort if too many bad choices were made.
+ if limit == 0 {
+ heapSortOrdered(data, a, b)
+ return
+ }
+
+ // If the last partitioning was imbalanced, we need to breaking patterns.
+ if !wasBalanced {
+ breakPatternsOrdered(data, a, b)
+ limit--
+ }
+
+ pivot, hint := choosePivotOrdered(data, a, b)
+ if hint == decreasingHint {
+ reverseRangeOrdered(data, a, b)
+ // The chosen pivot was pivot-a elements after the start of the array.
+ // After reversing it is pivot-a elements before the end of the array.
+ // The idea came from Rust's implementation.
+ pivot = (b - 1) - (pivot - a)
+ hint = increasingHint
+ }
+
+ // The slice is likely already sorted.
+ if wasBalanced && wasPartitioned && hint == increasingHint {
+ if partialInsertionSortOrdered(data, a, b) {
+ return
+ }
+ }
+
+ // Probably the slice contains many duplicate elements, partition the slice into
+ // elements equal to and elements greater than the pivot.
+ if a > 0 && !(data[a-1] < data[pivot]) {
+ mid := partitionEqualOrdered(data, a, b, pivot)
+ a = mid
+ continue
+ }
+
+ mid, alreadyPartitioned := partitionOrdered(data, a, b, pivot)
+ wasPartitioned = alreadyPartitioned
+
+ leftLen, rightLen := mid-a, b-mid
+ balanceThreshold := length / 8
+ if leftLen < rightLen {
+ wasBalanced = leftLen >= balanceThreshold
+ pdqsortOrdered(data, a, mid, limit)
+ a = mid + 1
+ } else {
+ wasBalanced = rightLen >= balanceThreshold
+ pdqsortOrdered(data, mid+1, b, limit)
+ b = mid
+ }
+ }
+}
+
+// partitionOrdered does one quicksort partition.
+// Let p = data[pivot]
+// Moves elements in data[a:b] around, so that data[i]=p for inewpivot.
+// On return, data[newpivot] = p
+func partitionOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int, alreadyPartitioned bool) {
+ data[a], data[pivot] = data[pivot], data[a]
+ i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned
+
+ for i <= j && (data[i] < data[a]) {
+ i++
+ }
+ for i <= j && !(data[j] < data[a]) {
+ j--
+ }
+ if i > j {
+ data[j], data[a] = data[a], data[j]
+ return j, true
+ }
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+
+ for {
+ for i <= j && (data[i] < data[a]) {
+ i++
+ }
+ for i <= j && !(data[j] < data[a]) {
+ j--
+ }
+ if i > j {
+ break
+ }
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+ }
+ data[j], data[a] = data[a], data[j]
+ return j, false
+}
+
+// partitionEqualOrdered partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot].
+// It assumed that data[a:b] does not contain elements smaller than the data[pivot].
+func partitionEqualOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int) {
+ data[a], data[pivot] = data[pivot], data[a]
+ i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned
+
+ for {
+ for i <= j && !(data[a] < data[i]) {
+ i++
+ }
+ for i <= j && (data[a] < data[j]) {
+ j--
+ }
+ if i > j {
+ break
+ }
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+ }
+ return i
+}
+
+// partialInsertionSortOrdered partially sorts a slice, returns true if the slice is sorted at the end.
+func partialInsertionSortOrdered[E constraints.Ordered](data []E, a, b int) bool {
+ const (
+ maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted
+ shortestShifting = 50 // don't shift any elements on short arrays
+ )
+ i := a + 1
+ for j := 0; j < maxSteps; j++ {
+ for i < b && !(data[i] < data[i-1]) {
+ i++
+ }
+
+ if i == b {
+ return true
+ }
+
+ if b-a < shortestShifting {
+ return false
+ }
+
+ data[i], data[i-1] = data[i-1], data[i]
+
+ // Shift the smaller one to the left.
+ if i-a >= 2 {
+ for j := i - 1; j >= 1; j-- {
+ if !(data[j] < data[j-1]) {
+ break
+ }
+ data[j], data[j-1] = data[j-1], data[j]
+ }
+ }
+ // Shift the greater one to the right.
+ if b-i >= 2 {
+ for j := i + 1; j < b; j++ {
+ if !(data[j] < data[j-1]) {
+ break
+ }
+ data[j], data[j-1] = data[j-1], data[j]
+ }
+ }
+ }
+ return false
+}
+
+// breakPatternsOrdered scatters some elements around in an attempt to break some patterns
+// that might cause imbalanced partitions in quicksort.
+func breakPatternsOrdered[E constraints.Ordered](data []E, a, b int) {
+ length := b - a
+ if length >= 8 {
+ random := xorshift(length)
+ modulus := nextPowerOfTwo(length)
+
+ for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ {
+ other := int(uint(random.Next()) & (modulus - 1))
+ if other >= length {
+ other -= length
+ }
+ data[idx], data[a+other] = data[a+other], data[idx]
+ }
+ }
+}
+
+// choosePivotOrdered chooses a pivot in data[a:b].
+//
+// [0,8): chooses a static pivot.
+// [8,shortestNinther): uses the simple median-of-three method.
+// [shortestNinther,∞): uses the Tukey ninther method.
+func choosePivotOrdered[E constraints.Ordered](data []E, a, b int) (pivot int, hint sortedHint) {
+ const (
+ shortestNinther = 50
+ maxSwaps = 4 * 3
+ )
+
+ l := b - a
+
+ var (
+ swaps int
+ i = a + l/4*1
+ j = a + l/4*2
+ k = a + l/4*3
+ )
+
+ if l >= 8 {
+ if l >= shortestNinther {
+ // Tukey ninther method, the idea came from Rust's implementation.
+ i = medianAdjacentOrdered(data, i, &swaps)
+ j = medianAdjacentOrdered(data, j, &swaps)
+ k = medianAdjacentOrdered(data, k, &swaps)
+ }
+ // Find the median among i, j, k and stores it into j.
+ j = medianOrdered(data, i, j, k, &swaps)
+ }
+
+ switch swaps {
+ case 0:
+ return j, increasingHint
+ case maxSwaps:
+ return j, decreasingHint
+ default:
+ return j, unknownHint
+ }
+}
+
+// order2Ordered returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a.
+func order2Ordered[E constraints.Ordered](data []E, a, b int, swaps *int) (int, int) {
+ if data[b] < data[a] {
+ *swaps++
+ return b, a
+ }
+ return a, b
+}
+
+// medianOrdered returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c.
+func medianOrdered[E constraints.Ordered](data []E, a, b, c int, swaps *int) int {
+ a, b = order2Ordered(data, a, b, swaps)
+ b, c = order2Ordered(data, b, c, swaps)
+ a, b = order2Ordered(data, a, b, swaps)
+ return b
+}
+
+// medianAdjacentOrdered finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a.
+func medianAdjacentOrdered[E constraints.Ordered](data []E, a int, swaps *int) int {
+ return medianOrdered(data, a-1, a, a+1, swaps)
+}
+
+func reverseRangeOrdered[E constraints.Ordered](data []E, a, b int) {
+ i := a
+ j := b - 1
+ for i < j {
+ data[i], data[j] = data[j], data[i]
+ i++
+ j--
+ }
+}
+
+func swapRangeOrdered[E constraints.Ordered](data []E, a, b, n int) {
+ for i := 0; i < n; i++ {
+ data[a+i], data[b+i] = data[b+i], data[a+i]
+ }
+}
+
+func stableOrdered[E constraints.Ordered](data []E, n int) {
+ blockSize := 20 // must be > 0
+ a, b := 0, blockSize
+ for b <= n {
+ insertionSortOrdered(data, a, b)
+ a = b
+ b += blockSize
+ }
+ insertionSortOrdered(data, a, n)
+
+ for blockSize < n {
+ a, b = 0, 2*blockSize
+ for b <= n {
+ symMergeOrdered(data, a, a+blockSize, b)
+ a = b
+ b += 2 * blockSize
+ }
+ if m := a + blockSize; m < n {
+ symMergeOrdered(data, a, m, n)
+ }
+ blockSize *= 2
+ }
+}
+
+// symMergeOrdered merges the two sorted subsequences data[a:m] and data[m:b] using
+// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum
+// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz
+// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in
+// Computer Science, pages 714-723. Springer, 2004.
+//
+// Let M = m-a and N = b-n. Wolog M < N.
+// The recursion depth is bound by ceil(log(N+M)).
+// The algorithm needs O(M*log(N/M + 1)) calls to data.Less.
+// The algorithm needs O((M+N)*log(M)) calls to data.Swap.
+//
+// The paper gives O((M+N)*log(M)) as the number of assignments assuming a
+// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation
+// in the paper carries through for Swap operations, especially as the block
+// swapping rotate uses only O(M+N) Swaps.
+//
+// symMerge assumes non-degenerate arguments: a < m && m < b.
+// Having the caller check this condition eliminates many leaf recursion calls,
+// which improves performance.
+func symMergeOrdered[E constraints.Ordered](data []E, a, m, b int) {
+ // Avoid unnecessary recursions of symMerge
+ // by direct insertion of data[a] into data[m:b]
+ // if data[a:m] only contains one element.
+ if m-a == 1 {
+ // Use binary search to find the lowest index i
+ // such that data[i] >= data[a] for m <= i < b.
+ // Exit the search loop with i == b in case no such index exists.
+ i := m
+ j := b
+ for i < j {
+ h := int(uint(i+j) >> 1)
+ if data[h] < data[a] {
+ i = h + 1
+ } else {
+ j = h
+ }
+ }
+ // Swap values until data[a] reaches the position before i.
+ for k := a; k < i-1; k++ {
+ data[k], data[k+1] = data[k+1], data[k]
+ }
+ return
+ }
+
+ // Avoid unnecessary recursions of symMerge
+ // by direct insertion of data[m] into data[a:m]
+ // if data[m:b] only contains one element.
+ if b-m == 1 {
+ // Use binary search to find the lowest index i
+ // such that data[i] > data[m] for a <= i < m.
+ // Exit the search loop with i == m in case no such index exists.
+ i := a
+ j := m
+ for i < j {
+ h := int(uint(i+j) >> 1)
+ if !(data[m] < data[h]) {
+ i = h + 1
+ } else {
+ j = h
+ }
+ }
+ // Swap values until data[m] reaches the position i.
+ for k := m; k > i; k-- {
+ data[k], data[k-1] = data[k-1], data[k]
+ }
+ return
+ }
+
+ mid := int(uint(a+b) >> 1)
+ n := mid + m
+ var start, r int
+ if m > mid {
+ start = n - b
+ r = mid
+ } else {
+ start = a
+ r = m
+ }
+ p := n - 1
+
+ for start < r {
+ c := int(uint(start+r) >> 1)
+ if !(data[p-c] < data[c]) {
+ start = c + 1
+ } else {
+ r = c
+ }
+ }
+
+ end := n - start
+ if start < m && m < end {
+ rotateOrdered(data, start, m, end)
+ }
+ if a < start && start < mid {
+ symMergeOrdered(data, a, start, mid)
+ }
+ if mid < end && end < b {
+ symMergeOrdered(data, mid, end, b)
+ }
+}
+
+// rotateOrdered rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data:
+// Data of the form 'x u v y' is changed to 'x v u y'.
+// rotate performs at most b-a many calls to data.Swap,
+// and it assumes non-degenerate arguments: a < m && m < b.
+func rotateOrdered[E constraints.Ordered](data []E, a, m, b int) {
+ i := m - a
+ j := b - m
+
+ for i != j {
+ if i > j {
+ swapRangeOrdered(data, m-i, m, j)
+ i -= j
+ } else {
+ swapRangeOrdered(data, m-i, m+j-i, i)
+ j -= i
+ }
+ }
+ // i == j
+ swapRangeOrdered(data, m-i, m, i)
+}
diff --git a/vendor/golang.org/x/sync/errgroup/errgroup.go b/vendor/golang.org/x/sync/errgroup/errgroup.go
index b18efb743..948a3ee63 100644
--- a/vendor/golang.org/x/sync/errgroup/errgroup.go
+++ b/vendor/golang.org/x/sync/errgroup/errgroup.go
@@ -4,6 +4,9 @@
// Package errgroup provides synchronization, error propagation, and Context
// cancelation for groups of goroutines working on subtasks of a common task.
+//
+// [errgroup.Group] is related to [sync.WaitGroup] but adds handling of tasks
+// returning errors.
package errgroup
import (
diff --git a/vendor/golang.org/x/sync/errgroup/go120.go b/vendor/golang.org/x/sync/errgroup/go120.go
index 7d419d376..f93c740b6 100644
--- a/vendor/golang.org/x/sync/errgroup/go120.go
+++ b/vendor/golang.org/x/sync/errgroup/go120.go
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build go1.20
-// +build go1.20
package errgroup
diff --git a/vendor/golang.org/x/sync/errgroup/pre_go120.go b/vendor/golang.org/x/sync/errgroup/pre_go120.go
index 1795c18ac..88ce33434 100644
--- a/vendor/golang.org/x/sync/errgroup/pre_go120.go
+++ b/vendor/golang.org/x/sync/errgroup/pre_go120.go
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !go1.20
-// +build !go1.20
package errgroup
diff --git a/vendor/golang.org/x/sync/singleflight/singleflight.go b/vendor/golang.org/x/sync/singleflight/singleflight.go
index 8473fb792..405183098 100644
--- a/vendor/golang.org/x/sync/singleflight/singleflight.go
+++ b/vendor/golang.org/x/sync/singleflight/singleflight.go
@@ -31,6 +31,15 @@ func (p *panicError) Error() string {
return fmt.Sprintf("%v\n\n%s", p.value, p.stack)
}
+func (p *panicError) Unwrap() error {
+ err, ok := p.value.(error)
+ if !ok {
+ return nil
+ }
+
+ return err
+}
+
func newPanicError(v interface{}) error {
stack := debug.Stack()
diff --git a/vendor/golang.org/x/sys/execabs/execabs.go b/vendor/golang.org/x/sys/execabs/execabs.go
deleted file mode 100644
index 3bf40fdfe..000000000
--- a/vendor/golang.org/x/sys/execabs/execabs.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// Copyright 2020 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package execabs is a drop-in replacement for os/exec
-// that requires PATH lookups to find absolute paths.
-// That is, execabs.Command("cmd") runs the same PATH lookup
-// as exec.Command("cmd"), but if the result is a path
-// which is relative, the Run and Start methods will report
-// an error instead of running the executable.
-//
-// See https://blog.golang.org/path-security for more information
-// about when it may be necessary or appropriate to use this package.
-package execabs
-
-import (
- "context"
- "fmt"
- "os/exec"
- "path/filepath"
- "reflect"
- "unsafe"
-)
-
-// ErrNotFound is the error resulting if a path search failed to find an executable file.
-// It is an alias for exec.ErrNotFound.
-var ErrNotFound = exec.ErrNotFound
-
-// Cmd represents an external command being prepared or run.
-// It is an alias for exec.Cmd.
-type Cmd = exec.Cmd
-
-// Error is returned by LookPath when it fails to classify a file as an executable.
-// It is an alias for exec.Error.
-type Error = exec.Error
-
-// An ExitError reports an unsuccessful exit by a command.
-// It is an alias for exec.ExitError.
-type ExitError = exec.ExitError
-
-func relError(file, path string) error {
- return fmt.Errorf("%s resolves to executable in current directory (.%c%s)", file, filepath.Separator, path)
-}
-
-// LookPath searches for an executable named file in the directories
-// named by the PATH environment variable. If file contains a slash,
-// it is tried directly and the PATH is not consulted. The result will be
-// an absolute path.
-//
-// LookPath differs from exec.LookPath in its handling of PATH lookups,
-// which are used for file names without slashes. If exec.LookPath's
-// PATH lookup would have returned an executable from the current directory,
-// LookPath instead returns an error.
-func LookPath(file string) (string, error) {
- path, err := exec.LookPath(file)
- if err != nil && !isGo119ErrDot(err) {
- return "", err
- }
- if filepath.Base(file) == file && !filepath.IsAbs(path) {
- return "", relError(file, path)
- }
- return path, nil
-}
-
-func fixCmd(name string, cmd *exec.Cmd) {
- if filepath.Base(name) == name && !filepath.IsAbs(cmd.Path) && !isGo119ErrFieldSet(cmd) {
- // exec.Command was called with a bare binary name and
- // exec.LookPath returned a path which is not absolute.
- // Set cmd.lookPathErr and clear cmd.Path so that it
- // cannot be run.
- lookPathErr := (*error)(unsafe.Pointer(reflect.ValueOf(cmd).Elem().FieldByName("lookPathErr").Addr().Pointer()))
- if *lookPathErr == nil {
- *lookPathErr = relError(name, cmd.Path)
- }
- cmd.Path = ""
- }
-}
-
-// CommandContext is like Command but includes a context.
-//
-// The provided context is used to kill the process (by calling os.Process.Kill)
-// if the context becomes done before the command completes on its own.
-func CommandContext(ctx context.Context, name string, arg ...string) *exec.Cmd {
- cmd := exec.CommandContext(ctx, name, arg...)
- fixCmd(name, cmd)
- return cmd
-
-}
-
-// Command returns the Cmd struct to execute the named program with the given arguments.
-// See exec.Command for most details.
-//
-// Command differs from exec.Command in its handling of PATH lookups,
-// which are used when the program name contains no slashes.
-// If exec.Command would have returned an exec.Cmd configured to run an
-// executable from the current directory, Command instead
-// returns an exec.Cmd that will return an error from Start or Run.
-func Command(name string, arg ...string) *exec.Cmd {
- cmd := exec.Command(name, arg...)
- fixCmd(name, cmd)
- return cmd
-}
diff --git a/vendor/golang.org/x/sys/execabs/execabs_go118.go b/vendor/golang.org/x/sys/execabs/execabs_go118.go
deleted file mode 100644
index 5627d70e3..000000000
--- a/vendor/golang.org/x/sys/execabs/execabs_go118.go
+++ /dev/null
@@ -1,17 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build !go1.19
-
-package execabs
-
-import "os/exec"
-
-func isGo119ErrDot(err error) bool {
- return false
-}
-
-func isGo119ErrFieldSet(cmd *exec.Cmd) bool {
- return false
-}
diff --git a/vendor/golang.org/x/sys/execabs/execabs_go119.go b/vendor/golang.org/x/sys/execabs/execabs_go119.go
deleted file mode 100644
index d60ab1b41..000000000
--- a/vendor/golang.org/x/sys/execabs/execabs_go119.go
+++ /dev/null
@@ -1,20 +0,0 @@
-// Copyright 2022 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build go1.19
-
-package execabs
-
-import (
- "errors"
- "os/exec"
-)
-
-func isGo119ErrDot(err error) bool {
- return errors.Is(err, exec.ErrDot)
-}
-
-func isGo119ErrFieldSet(cmd *exec.Cmd) bool {
- return cmd.Err != nil
-}
diff --git a/vendor/golang.org/x/text/feature/plural/common.go b/vendor/golang.org/x/text/feature/plural/common.go
new file mode 100644
index 000000000..fdcb373fd
--- /dev/null
+++ b/vendor/golang.org/x/text/feature/plural/common.go
@@ -0,0 +1,70 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package plural
+
+// Form defines a plural form.
+//
+// Not all languages support all forms. Also, the meaning of each form varies
+// per language. It is important to note that the name of a form does not
+// necessarily correspond one-to-one with the set of numbers. For instance,
+// for Croation, One matches not only 1, but also 11, 21, etc.
+//
+// Each language must at least support the form "other".
+type Form byte
+
+const (
+ Other Form = iota
+ Zero
+ One
+ Two
+ Few
+ Many
+)
+
+var countMap = map[string]Form{
+ "other": Other,
+ "zero": Zero,
+ "one": One,
+ "two": Two,
+ "few": Few,
+ "many": Many,
+}
+
+type pluralCheck struct {
+ // category:
+ // 3..7: opID
+ // 0..2: category
+ cat byte
+ setID byte
+}
+
+// opID identifies the type of operand in the plural rule, being i, n or f.
+// (v, w, and t are treated as filters in our implementation.)
+type opID byte
+
+const (
+ opMod opID = 0x1 // is '%' used?
+ opNotEqual opID = 0x2 // using "!=" to compare
+ opI opID = 0 << 2 // integers after taking the absolute value
+ opN opID = 1 << 2 // full number (must be integer)
+ opF opID = 2 << 2 // fraction
+ opV opID = 3 << 2 // number of visible digits
+ opW opID = 4 << 2 // number of visible digits without trailing zeros
+ opBretonM opID = 5 << 2 // hard-wired rule for Breton
+ opItalian800 opID = 6 << 2 // hard-wired rule for Italian
+ opAzerbaijan00s opID = 7 << 2 // hard-wired rule for Azerbaijan
+)
+const (
+ // Use this plural form to indicate the next rule needs to match as well.
+ // The last condition in the list will have the correct plural form.
+ andNext = 0x7
+ formMask = 0x7
+
+ opShift = 3
+
+ // numN indicates the maximum integer, or maximum mod value, for which we
+ // have inclusion masks.
+ numN = 100
+ // The common denominator of the modulo that is taken.
+ maxMod = 100
+)
diff --git a/vendor/golang.org/x/text/feature/plural/message.go b/vendor/golang.org/x/text/feature/plural/message.go
new file mode 100644
index 000000000..56d518cc3
--- /dev/null
+++ b/vendor/golang.org/x/text/feature/plural/message.go
@@ -0,0 +1,244 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package plural
+
+import (
+ "fmt"
+ "io"
+ "reflect"
+ "strconv"
+
+ "golang.org/x/text/internal/catmsg"
+ "golang.org/x/text/internal/number"
+ "golang.org/x/text/language"
+ "golang.org/x/text/message/catalog"
+)
+
+// TODO: consider deleting this interface. Maybe VisibleDigits is always
+// sufficient and practical.
+
+// Interface is used for types that can determine their own plural form.
+type Interface interface {
+ // PluralForm reports the plural form for the given language of the
+ // underlying value. It also returns the integer value. If the integer value
+ // is larger than fits in n, PluralForm may return a value modulo
+ // 10,000,000.
+ PluralForm(t language.Tag, scale int) (f Form, n int)
+}
+
+// Selectf returns the first case for which its selector is a match for the
+// arg-th substitution argument to a formatting call, formatting it as indicated
+// by format.
+//
+// The cases argument are pairs of selectors and messages. Selectors are of type
+// string or Form. Messages are of type string or catalog.Message. A selector
+// matches an argument if:
+// - it is "other" or Other
+// - it matches the plural form of the argument: "zero", "one", "two", "few",
+// or "many", or the equivalent Form
+// - it is of the form "=x" where x is an integer that matches the value of
+// the argument.
+// - it is of the form " kindDefault {
+ e.EncodeUint(uint64(m.scale))
+ }
+
+ forms := validForms(cardinal, e.Language())
+
+ for i := 0; i < len(m.cases); {
+ if err := compileSelector(e, forms, m.cases[i]); err != nil {
+ return err
+ }
+ if i++; i >= len(m.cases) {
+ return fmt.Errorf("plural: no message defined for selector %v", m.cases[i-1])
+ }
+ var msg catalog.Message
+ switch x := m.cases[i].(type) {
+ case string:
+ msg = catalog.String(x)
+ case catalog.Message:
+ msg = x
+ default:
+ return fmt.Errorf("plural: message of type %T; must be string or catalog.Message", x)
+ }
+ if err := e.EncodeMessage(msg); err != nil {
+ return err
+ }
+ i++
+ }
+ return nil
+}
+
+func compileSelector(e *catmsg.Encoder, valid []Form, selector interface{}) error {
+ form := Other
+ switch x := selector.(type) {
+ case string:
+ if x == "" {
+ return fmt.Errorf("plural: empty selector")
+ }
+ if c := x[0]; c == '=' || c == '<' {
+ val, err := strconv.ParseUint(x[1:], 10, 16)
+ if err != nil {
+ return fmt.Errorf("plural: invalid number in selector %q: %v", selector, err)
+ }
+ e.EncodeUint(uint64(c))
+ e.EncodeUint(val)
+ return nil
+ }
+ var ok bool
+ form, ok = countMap[x]
+ if !ok {
+ return fmt.Errorf("plural: invalid plural form %q", selector)
+ }
+ case Form:
+ form = x
+ default:
+ return fmt.Errorf("plural: selector of type %T; want string or Form", selector)
+ }
+
+ ok := false
+ for _, f := range valid {
+ if f == form {
+ ok = true
+ break
+ }
+ }
+ if !ok {
+ return fmt.Errorf("plural: form %q not supported for language %q", selector, e.Language())
+ }
+ e.EncodeUint(uint64(form))
+ return nil
+}
+
+func execute(d *catmsg.Decoder) bool {
+ lang := d.Language()
+ argN := int(d.DecodeUint())
+ kind := int(d.DecodeUint())
+ scale := -1 // default
+ if kind > kindDefault {
+ scale = int(d.DecodeUint())
+ }
+ form := Other
+ n := -1
+ if arg := d.Arg(argN); arg == nil {
+ // Default to Other.
+ } else if x, ok := arg.(number.VisibleDigits); ok {
+ d := x.Digits(nil, lang, scale)
+ form, n = cardinal.matchDisplayDigits(lang, &d)
+ } else if x, ok := arg.(Interface); ok {
+ // This covers lists and formatters from the number package.
+ form, n = x.PluralForm(lang, scale)
+ } else {
+ var f number.Formatter
+ switch kind {
+ case kindScale:
+ f.InitDecimal(lang)
+ f.SetScale(scale)
+ case kindScientific:
+ f.InitScientific(lang)
+ f.SetScale(scale)
+ case kindPrecision:
+ f.InitDecimal(lang)
+ f.SetPrecision(scale)
+ case kindDefault:
+ // sensible default
+ f.InitDecimal(lang)
+ if k := reflect.TypeOf(arg).Kind(); reflect.Int <= k && k <= reflect.Uintptr {
+ f.SetScale(0)
+ } else {
+ f.SetScale(2)
+ }
+ }
+ var dec number.Decimal // TODO: buffer in Printer
+ dec.Convert(f.RoundingContext, arg)
+ v := number.FormatDigits(&dec, f.RoundingContext)
+ if !v.NaN && !v.Inf {
+ form, n = cardinal.matchDisplayDigits(d.Language(), &v)
+ }
+ }
+ for !d.Done() {
+ f := d.DecodeUint()
+ if (f == '=' && n == int(d.DecodeUint())) ||
+ (f == '<' && 0 <= n && n < int(d.DecodeUint())) ||
+ form == Form(f) ||
+ Other == Form(f) {
+ return d.ExecuteMessage()
+ }
+ d.SkipMessage()
+ }
+ return false
+}
diff --git a/vendor/golang.org/x/text/feature/plural/plural.go b/vendor/golang.org/x/text/feature/plural/plural.go
new file mode 100644
index 000000000..e9f2d42e0
--- /dev/null
+++ b/vendor/golang.org/x/text/feature/plural/plural.go
@@ -0,0 +1,262 @@
+// Copyright 2016 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go
+
+// Package plural provides utilities for handling linguistic plurals in text.
+//
+// The definitions in this package are based on the plural rule handling defined
+// in CLDR. See
+// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules for
+// details.
+package plural
+
+import (
+ "golang.org/x/text/internal/language/compact"
+ "golang.org/x/text/internal/number"
+ "golang.org/x/text/language"
+)
+
+// Rules defines the plural rules for all languages for a certain plural type.
+//
+// This package is UNDER CONSTRUCTION and its API may change.
+type Rules struct {
+ rules []pluralCheck
+ index []byte
+ langToIndex []byte
+ inclusionMasks []uint64
+}
+
+var (
+ // Cardinal defines the plural rules for numbers indicating quantities.
+ Cardinal *Rules = cardinal
+
+ // Ordinal defines the plural rules for numbers indicating position
+ // (first, second, etc.).
+ Ordinal *Rules = ordinal
+
+ ordinal = &Rules{
+ ordinalRules,
+ ordinalIndex,
+ ordinalLangToIndex,
+ ordinalInclusionMasks[:],
+ }
+
+ cardinal = &Rules{
+ cardinalRules,
+ cardinalIndex,
+ cardinalLangToIndex,
+ cardinalInclusionMasks[:],
+ }
+)
+
+// getIntApprox converts the digits in slice digits[start:end] to an integer
+// according to the following rules:
+// - Let i be asInt(digits[start:end]), where out-of-range digits are assumed
+// to be zero.
+// - Result n is big if i / 10^nMod > 1.
+// - Otherwise the result is i % 10^nMod.
+//
+// For example, if digits is {1, 2, 3} and start:end is 0:5, then the result
+// for various values of nMod is:
+// - when nMod == 2, n == big
+// - when nMod == 3, n == big
+// - when nMod == 4, n == big
+// - when nMod == 5, n == 12300
+// - when nMod == 6, n == 12300
+// - when nMod == 7, n == 12300
+func getIntApprox(digits []byte, start, end, nMod, big int) (n int) {
+ // Leading 0 digits just result in 0.
+ p := start
+ if p < 0 {
+ p = 0
+ }
+ // Range only over the part for which we have digits.
+ mid := end
+ if mid >= len(digits) {
+ mid = len(digits)
+ }
+ // Check digits more significant that nMod.
+ if q := end - nMod; q > 0 {
+ if q > mid {
+ q = mid
+ }
+ for ; p < q; p++ {
+ if digits[p] != 0 {
+ return big
+ }
+ }
+ }
+ for ; p < mid; p++ {
+ n = 10*n + int(digits[p])
+ }
+ // Multiply for trailing zeros.
+ for ; p < end; p++ {
+ n *= 10
+ }
+ return n
+}
+
+// MatchDigits computes the plural form for the given language and the given
+// decimal floating point digits. The digits are stored in big-endian order and
+// are of value byte(0) - byte(9). The floating point position is indicated by
+// exp and the number of visible decimals is scale. All leading and trailing
+// zeros may be omitted from digits.
+//
+// The following table contains examples of possible arguments to represent
+// the given numbers.
+//
+// decimal digits exp scale
+// 123 []byte{1, 2, 3} 3 0
+// 123.4 []byte{1, 2, 3, 4} 3 1
+// 123.40 []byte{1, 2, 3, 4} 3 2
+// 100000 []byte{1} 6 0
+// 100000.00 []byte{1} 6 3
+func (p *Rules) MatchDigits(t language.Tag, digits []byte, exp, scale int) Form {
+ index := tagToID(t)
+
+ // Differentiate up to including mod 1000000 for the integer part.
+ n := getIntApprox(digits, 0, exp, 6, 1000000)
+
+ // Differentiate up to including mod 100 for the fractional part.
+ f := getIntApprox(digits, exp, exp+scale, 2, 100)
+
+ return matchPlural(p, index, n, f, scale)
+}
+
+func (p *Rules) matchDisplayDigits(t language.Tag, d *number.Digits) (Form, int) {
+ n := getIntApprox(d.Digits, 0, int(d.Exp), 6, 1000000)
+ return p.MatchDigits(t, d.Digits, int(d.Exp), d.NumFracDigits()), n
+}
+
+func validForms(p *Rules, t language.Tag) (forms []Form) {
+ offset := p.langToIndex[tagToID(t)]
+ rules := p.rules[p.index[offset]:p.index[offset+1]]
+
+ forms = append(forms, Other)
+ last := Other
+ for _, r := range rules {
+ if cat := Form(r.cat & formMask); cat != andNext && last != cat {
+ forms = append(forms, cat)
+ last = cat
+ }
+ }
+ return forms
+}
+
+func (p *Rules) matchComponents(t language.Tag, n, f, scale int) Form {
+ return matchPlural(p, tagToID(t), n, f, scale)
+}
+
+// MatchPlural returns the plural form for the given language and plural
+// operands (as defined in
+// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules):
+//
+// where
+// n absolute value of the source number (integer and decimals)
+// input
+// i integer digits of n.
+// v number of visible fraction digits in n, with trailing zeros.
+// w number of visible fraction digits in n, without trailing zeros.
+// f visible fractional digits in n, with trailing zeros (f = t * 10^(v-w))
+// t visible fractional digits in n, without trailing zeros.
+//
+// If any of the operand values is too large to fit in an int, it is okay to
+// pass the value modulo 10,000,000.
+func (p *Rules) MatchPlural(lang language.Tag, i, v, w, f, t int) Form {
+ return matchPlural(p, tagToID(lang), i, f, v)
+}
+
+func matchPlural(p *Rules, index compact.ID, n, f, v int) Form {
+ nMask := p.inclusionMasks[n%maxMod]
+ // Compute the fMask inline in the rules below, as it is relatively rare.
+ // fMask := p.inclusionMasks[f%maxMod]
+ vMask := p.inclusionMasks[v%maxMod]
+
+ // Do the matching
+ offset := p.langToIndex[index]
+ rules := p.rules[p.index[offset]:p.index[offset+1]]
+ for i := 0; i < len(rules); i++ {
+ rule := rules[i]
+ setBit := uint64(1 << rule.setID)
+ var skip bool
+ switch op := opID(rule.cat >> opShift); op {
+ case opI: // i = x
+ skip = n >= numN || nMask&setBit == 0
+
+ case opI | opNotEqual: // i != x
+ skip = n < numN && nMask&setBit != 0
+
+ case opI | opMod: // i % m = x
+ skip = nMask&setBit == 0
+
+ case opI | opMod | opNotEqual: // i % m != x
+ skip = nMask&setBit != 0
+
+ case opN: // n = x
+ skip = f != 0 || n >= numN || nMask&setBit == 0
+
+ case opN | opNotEqual: // n != x
+ skip = f == 0 && n < numN && nMask&setBit != 0
+
+ case opN | opMod: // n % m = x
+ skip = f != 0 || nMask&setBit == 0
+
+ case opN | opMod | opNotEqual: // n % m != x
+ skip = f == 0 && nMask&setBit != 0
+
+ case opF: // f = x
+ skip = f >= numN || p.inclusionMasks[f%maxMod]&setBit == 0
+
+ case opF | opNotEqual: // f != x
+ skip = f < numN && p.inclusionMasks[f%maxMod]&setBit != 0
+
+ case opF | opMod: // f % m = x
+ skip = p.inclusionMasks[f%maxMod]&setBit == 0
+
+ case opF | opMod | opNotEqual: // f % m != x
+ skip = p.inclusionMasks[f%maxMod]&setBit != 0
+
+ case opV: // v = x
+ skip = v < numN && vMask&setBit == 0
+
+ case opV | opNotEqual: // v != x
+ skip = v < numN && vMask&setBit != 0
+
+ case opW: // w == 0
+ skip = f != 0
+
+ case opW | opNotEqual: // w != 0
+ skip = f == 0
+
+ // Hard-wired rules that cannot be handled by our algorithm.
+
+ case opBretonM:
+ skip = f != 0 || n == 0 || n%1000000 != 0
+
+ case opAzerbaijan00s:
+ // 100,200,300,400,500,600,700,800,900
+ skip = n == 0 || n >= 1000 || n%100 != 0
+
+ case opItalian800:
+ skip = (f != 0 || n >= numN || nMask&setBit == 0) && n != 800
+ }
+ if skip {
+ // advance over AND entries.
+ for ; i < len(rules) && rules[i].cat&formMask == andNext; i++ {
+ }
+ continue
+ }
+ // return if we have a final entry.
+ if cat := rule.cat & formMask; cat != andNext {
+ return Form(cat)
+ }
+ }
+ return Other
+}
+
+func tagToID(t language.Tag) compact.ID {
+ id, _ := compact.RegionalID(compact.Tag(t))
+ return id
+}
diff --git a/vendor/golang.org/x/text/feature/plural/tables.go b/vendor/golang.org/x/text/feature/plural/tables.go
new file mode 100644
index 000000000..b06b9cb4e
--- /dev/null
+++ b/vendor/golang.org/x/text/feature/plural/tables.go
@@ -0,0 +1,552 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package plural
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+var ordinalRules = []pluralCheck{ // 64 elements
+ 0: {cat: 0x2f, setID: 0x4},
+ 1: {cat: 0x3a, setID: 0x5},
+ 2: {cat: 0x22, setID: 0x1},
+ 3: {cat: 0x22, setID: 0x6},
+ 4: {cat: 0x22, setID: 0x7},
+ 5: {cat: 0x2f, setID: 0x8},
+ 6: {cat: 0x3c, setID: 0x9},
+ 7: {cat: 0x2f, setID: 0xa},
+ 8: {cat: 0x3c, setID: 0xb},
+ 9: {cat: 0x2c, setID: 0xc},
+ 10: {cat: 0x24, setID: 0xd},
+ 11: {cat: 0x2d, setID: 0xe},
+ 12: {cat: 0x2d, setID: 0xf},
+ 13: {cat: 0x2f, setID: 0x10},
+ 14: {cat: 0x35, setID: 0x3},
+ 15: {cat: 0xc5, setID: 0x11},
+ 16: {cat: 0x2, setID: 0x1},
+ 17: {cat: 0x5, setID: 0x3},
+ 18: {cat: 0xd, setID: 0x12},
+ 19: {cat: 0x22, setID: 0x1},
+ 20: {cat: 0x2f, setID: 0x13},
+ 21: {cat: 0x3d, setID: 0x14},
+ 22: {cat: 0x2f, setID: 0x15},
+ 23: {cat: 0x3a, setID: 0x16},
+ 24: {cat: 0x2f, setID: 0x17},
+ 25: {cat: 0x3b, setID: 0x18},
+ 26: {cat: 0x2f, setID: 0xa},
+ 27: {cat: 0x3c, setID: 0xb},
+ 28: {cat: 0x22, setID: 0x1},
+ 29: {cat: 0x23, setID: 0x19},
+ 30: {cat: 0x24, setID: 0x1a},
+ 31: {cat: 0x22, setID: 0x1b},
+ 32: {cat: 0x23, setID: 0x2},
+ 33: {cat: 0x24, setID: 0x1a},
+ 34: {cat: 0xf, setID: 0x15},
+ 35: {cat: 0x1a, setID: 0x16},
+ 36: {cat: 0xf, setID: 0x17},
+ 37: {cat: 0x1b, setID: 0x18},
+ 38: {cat: 0xf, setID: 0x1c},
+ 39: {cat: 0x1d, setID: 0x1d},
+ 40: {cat: 0xa, setID: 0x1e},
+ 41: {cat: 0xa, setID: 0x1f},
+ 42: {cat: 0xc, setID: 0x20},
+ 43: {cat: 0xe4, setID: 0x0},
+ 44: {cat: 0x5, setID: 0x3},
+ 45: {cat: 0xd, setID: 0xe},
+ 46: {cat: 0xd, setID: 0x21},
+ 47: {cat: 0x22, setID: 0x1},
+ 48: {cat: 0x23, setID: 0x19},
+ 49: {cat: 0x24, setID: 0x1a},
+ 50: {cat: 0x25, setID: 0x22},
+ 51: {cat: 0x22, setID: 0x23},
+ 52: {cat: 0x23, setID: 0x19},
+ 53: {cat: 0x24, setID: 0x1a},
+ 54: {cat: 0x25, setID: 0x22},
+ 55: {cat: 0x22, setID: 0x24},
+ 56: {cat: 0x23, setID: 0x19},
+ 57: {cat: 0x24, setID: 0x1a},
+ 58: {cat: 0x25, setID: 0x22},
+ 59: {cat: 0x21, setID: 0x25},
+ 60: {cat: 0x22, setID: 0x1},
+ 61: {cat: 0x23, setID: 0x2},
+ 62: {cat: 0x24, setID: 0x26},
+ 63: {cat: 0x25, setID: 0x27},
+} // Size: 152 bytes
+
+var ordinalIndex = []uint8{ // 22 elements
+ 0x00, 0x00, 0x02, 0x03, 0x04, 0x05, 0x07, 0x09,
+ 0x0b, 0x0f, 0x10, 0x13, 0x16, 0x1c, 0x1f, 0x22,
+ 0x28, 0x2f, 0x33, 0x37, 0x3b, 0x40,
+} // Size: 46 bytes
+
+var ordinalLangToIndex = []uint8{ // 775 elements
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x10, 0x10,
+ 0x10, 0x10, 0x10, 0x00, 0x00, 0x05, 0x05, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x12, 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e,
+ 0x0e, 0x0e, 0x0e, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x14, 0x14, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ // Entry C0 - FF
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
+ 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02,
+ 0x00, 0x00, 0x00, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ // Entry 140 - 17F
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x11, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x11,
+ 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x03,
+ 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x09, 0x09, 0x09, 0x09,
+ 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x0a, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x0f, 0x0f, 0x00, 0x00,
+ 0x00, 0x00, 0x02, 0x0d, 0x0d, 0x02, 0x02, 0x02,
+ 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x13, 0x13, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02,
+ 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x0b, 0x0b, 0x0b, 0x0b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x01,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x07, 0x07, 0x02, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x0c,
+} // Size: 799 bytes
+
+var ordinalInclusionMasks = []uint64{ // 100 elements
+ // Entry 0 - 1F
+ 0x0000002000010009, 0x00000018482000d3, 0x0000000042840195, 0x000000410a040581,
+ 0x00000041040c0081, 0x0000009840040041, 0x0000008400045001, 0x0000003850040001,
+ 0x0000003850060001, 0x0000003800049001, 0x0000000800052001, 0x0000000040660031,
+ 0x0000000041840331, 0x0000000100040f01, 0x00000001001c0001, 0x0000000040040001,
+ 0x0000000000045001, 0x0000000070040001, 0x0000000070040001, 0x0000000000049001,
+ 0x0000000080050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501,
+ 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001,
+ 0x0000000050000001, 0x0000000000009001, 0x0000000000010001, 0x0000000040200011,
+ // Entry 20 - 3F
+ 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001,
+ 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001,
+ 0x0000000200050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501,
+ 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001,
+ 0x0000000050000001, 0x0000000000009001, 0x0000000080010001, 0x0000000040200011,
+ 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001,
+ 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001,
+ 0x0000000200050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501,
+ // Entry 40 - 5F
+ 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001,
+ 0x0000000050000001, 0x0000000000009001, 0x0000000080010001, 0x0000000040200011,
+ 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001,
+ 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001,
+ 0x0000000080070001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501,
+ 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001,
+ 0x0000000050000001, 0x0000000000009001, 0x0000000200010001, 0x0000000040200011,
+ 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001,
+ // Entry 60 - 7F
+ 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001,
+} // Size: 824 bytes
+
+// Slots used for ordinal: 40 of 0xFF rules; 16 of 0xFF indexes; 40 of 64 sets
+
+var cardinalRules = []pluralCheck{ // 166 elements
+ 0: {cat: 0x2, setID: 0x3},
+ 1: {cat: 0x22, setID: 0x1},
+ 2: {cat: 0x2, setID: 0x4},
+ 3: {cat: 0x2, setID: 0x4},
+ 4: {cat: 0x7, setID: 0x1},
+ 5: {cat: 0x62, setID: 0x3},
+ 6: {cat: 0x22, setID: 0x4},
+ 7: {cat: 0x7, setID: 0x3},
+ 8: {cat: 0x42, setID: 0x1},
+ 9: {cat: 0x22, setID: 0x4},
+ 10: {cat: 0x22, setID: 0x4},
+ 11: {cat: 0x22, setID: 0x5},
+ 12: {cat: 0x22, setID: 0x1},
+ 13: {cat: 0x22, setID: 0x1},
+ 14: {cat: 0x7, setID: 0x4},
+ 15: {cat: 0x92, setID: 0x3},
+ 16: {cat: 0xf, setID: 0x6},
+ 17: {cat: 0x1f, setID: 0x7},
+ 18: {cat: 0x82, setID: 0x3},
+ 19: {cat: 0x92, setID: 0x3},
+ 20: {cat: 0xf, setID: 0x6},
+ 21: {cat: 0x62, setID: 0x3},
+ 22: {cat: 0x4a, setID: 0x6},
+ 23: {cat: 0x7, setID: 0x8},
+ 24: {cat: 0x62, setID: 0x3},
+ 25: {cat: 0x1f, setID: 0x9},
+ 26: {cat: 0x62, setID: 0x3},
+ 27: {cat: 0x5f, setID: 0x9},
+ 28: {cat: 0x72, setID: 0x3},
+ 29: {cat: 0x29, setID: 0xa},
+ 30: {cat: 0x29, setID: 0xb},
+ 31: {cat: 0x4f, setID: 0xb},
+ 32: {cat: 0x61, setID: 0x2},
+ 33: {cat: 0x2f, setID: 0x6},
+ 34: {cat: 0x3a, setID: 0x7},
+ 35: {cat: 0x4f, setID: 0x6},
+ 36: {cat: 0x5f, setID: 0x7},
+ 37: {cat: 0x62, setID: 0x2},
+ 38: {cat: 0x4f, setID: 0x6},
+ 39: {cat: 0x72, setID: 0x2},
+ 40: {cat: 0x21, setID: 0x3},
+ 41: {cat: 0x7, setID: 0x4},
+ 42: {cat: 0x32, setID: 0x3},
+ 43: {cat: 0x21, setID: 0x3},
+ 44: {cat: 0x22, setID: 0x1},
+ 45: {cat: 0x22, setID: 0x1},
+ 46: {cat: 0x23, setID: 0x2},
+ 47: {cat: 0x2, setID: 0x3},
+ 48: {cat: 0x22, setID: 0x1},
+ 49: {cat: 0x24, setID: 0xc},
+ 50: {cat: 0x7, setID: 0x1},
+ 51: {cat: 0x62, setID: 0x3},
+ 52: {cat: 0x74, setID: 0x3},
+ 53: {cat: 0x24, setID: 0x3},
+ 54: {cat: 0x2f, setID: 0xd},
+ 55: {cat: 0x34, setID: 0x1},
+ 56: {cat: 0xf, setID: 0x6},
+ 57: {cat: 0x1f, setID: 0x7},
+ 58: {cat: 0x62, setID: 0x3},
+ 59: {cat: 0x4f, setID: 0x6},
+ 60: {cat: 0x5a, setID: 0x7},
+ 61: {cat: 0xf, setID: 0xe},
+ 62: {cat: 0x1f, setID: 0xf},
+ 63: {cat: 0x64, setID: 0x3},
+ 64: {cat: 0x4f, setID: 0xe},
+ 65: {cat: 0x5c, setID: 0xf},
+ 66: {cat: 0x22, setID: 0x10},
+ 67: {cat: 0x23, setID: 0x11},
+ 68: {cat: 0x24, setID: 0x12},
+ 69: {cat: 0xf, setID: 0x1},
+ 70: {cat: 0x62, setID: 0x3},
+ 71: {cat: 0xf, setID: 0x2},
+ 72: {cat: 0x63, setID: 0x3},
+ 73: {cat: 0xf, setID: 0x13},
+ 74: {cat: 0x64, setID: 0x3},
+ 75: {cat: 0x74, setID: 0x3},
+ 76: {cat: 0xf, setID: 0x1},
+ 77: {cat: 0x62, setID: 0x3},
+ 78: {cat: 0x4a, setID: 0x1},
+ 79: {cat: 0xf, setID: 0x2},
+ 80: {cat: 0x63, setID: 0x3},
+ 81: {cat: 0x4b, setID: 0x2},
+ 82: {cat: 0xf, setID: 0x13},
+ 83: {cat: 0x64, setID: 0x3},
+ 84: {cat: 0x4c, setID: 0x13},
+ 85: {cat: 0x7, setID: 0x1},
+ 86: {cat: 0x62, setID: 0x3},
+ 87: {cat: 0x7, setID: 0x2},
+ 88: {cat: 0x63, setID: 0x3},
+ 89: {cat: 0x2f, setID: 0xa},
+ 90: {cat: 0x37, setID: 0x14},
+ 91: {cat: 0x65, setID: 0x3},
+ 92: {cat: 0x7, setID: 0x1},
+ 93: {cat: 0x62, setID: 0x3},
+ 94: {cat: 0x7, setID: 0x15},
+ 95: {cat: 0x64, setID: 0x3},
+ 96: {cat: 0x75, setID: 0x3},
+ 97: {cat: 0x7, setID: 0x1},
+ 98: {cat: 0x62, setID: 0x3},
+ 99: {cat: 0xf, setID: 0xe},
+ 100: {cat: 0x1f, setID: 0xf},
+ 101: {cat: 0x64, setID: 0x3},
+ 102: {cat: 0xf, setID: 0x16},
+ 103: {cat: 0x17, setID: 0x1},
+ 104: {cat: 0x65, setID: 0x3},
+ 105: {cat: 0xf, setID: 0x17},
+ 106: {cat: 0x65, setID: 0x3},
+ 107: {cat: 0xf, setID: 0xf},
+ 108: {cat: 0x65, setID: 0x3},
+ 109: {cat: 0x2f, setID: 0x6},
+ 110: {cat: 0x3a, setID: 0x7},
+ 111: {cat: 0x2f, setID: 0xe},
+ 112: {cat: 0x3c, setID: 0xf},
+ 113: {cat: 0x2d, setID: 0xa},
+ 114: {cat: 0x2d, setID: 0x17},
+ 115: {cat: 0x2d, setID: 0x18},
+ 116: {cat: 0x2f, setID: 0x6},
+ 117: {cat: 0x3a, setID: 0xb},
+ 118: {cat: 0x2f, setID: 0x19},
+ 119: {cat: 0x3c, setID: 0xb},
+ 120: {cat: 0x55, setID: 0x3},
+ 121: {cat: 0x22, setID: 0x1},
+ 122: {cat: 0x24, setID: 0x3},
+ 123: {cat: 0x2c, setID: 0xc},
+ 124: {cat: 0x2d, setID: 0xb},
+ 125: {cat: 0xf, setID: 0x6},
+ 126: {cat: 0x1f, setID: 0x7},
+ 127: {cat: 0x62, setID: 0x3},
+ 128: {cat: 0xf, setID: 0xe},
+ 129: {cat: 0x1f, setID: 0xf},
+ 130: {cat: 0x64, setID: 0x3},
+ 131: {cat: 0xf, setID: 0xa},
+ 132: {cat: 0x65, setID: 0x3},
+ 133: {cat: 0xf, setID: 0x17},
+ 134: {cat: 0x65, setID: 0x3},
+ 135: {cat: 0xf, setID: 0x18},
+ 136: {cat: 0x65, setID: 0x3},
+ 137: {cat: 0x2f, setID: 0x6},
+ 138: {cat: 0x3a, setID: 0x1a},
+ 139: {cat: 0x2f, setID: 0x1b},
+ 140: {cat: 0x3b, setID: 0x1c},
+ 141: {cat: 0x2f, setID: 0x1d},
+ 142: {cat: 0x3c, setID: 0x1e},
+ 143: {cat: 0x37, setID: 0x3},
+ 144: {cat: 0xa5, setID: 0x0},
+ 145: {cat: 0x22, setID: 0x1},
+ 146: {cat: 0x23, setID: 0x2},
+ 147: {cat: 0x24, setID: 0x1f},
+ 148: {cat: 0x25, setID: 0x20},
+ 149: {cat: 0xf, setID: 0x6},
+ 150: {cat: 0x62, setID: 0x3},
+ 151: {cat: 0xf, setID: 0x1b},
+ 152: {cat: 0x63, setID: 0x3},
+ 153: {cat: 0xf, setID: 0x21},
+ 154: {cat: 0x64, setID: 0x3},
+ 155: {cat: 0x75, setID: 0x3},
+ 156: {cat: 0x21, setID: 0x3},
+ 157: {cat: 0x22, setID: 0x1},
+ 158: {cat: 0x23, setID: 0x2},
+ 159: {cat: 0x2c, setID: 0x22},
+ 160: {cat: 0x2d, setID: 0x5},
+ 161: {cat: 0x21, setID: 0x3},
+ 162: {cat: 0x22, setID: 0x1},
+ 163: {cat: 0x23, setID: 0x2},
+ 164: {cat: 0x24, setID: 0x23},
+ 165: {cat: 0x25, setID: 0x24},
+} // Size: 356 bytes
+
+var cardinalIndex = []uint8{ // 36 elements
+ 0x00, 0x00, 0x02, 0x03, 0x04, 0x06, 0x09, 0x0a,
+ 0x0c, 0x0d, 0x10, 0x14, 0x17, 0x1d, 0x28, 0x2b,
+ 0x2d, 0x2f, 0x32, 0x38, 0x42, 0x45, 0x4c, 0x55,
+ 0x5c, 0x61, 0x6d, 0x74, 0x79, 0x7d, 0x89, 0x91,
+ 0x95, 0x9c, 0xa1, 0xa6,
+} // Size: 60 bytes
+
+var cardinalLangToIndex = []uint8{ // 775 elements
+ // Entry 0 - 3F
+ 0x00, 0x08, 0x08, 0x08, 0x00, 0x00, 0x06, 0x06,
+ 0x01, 0x01, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x01, 0x01, 0x08, 0x08, 0x04, 0x04, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x00, 0x00, 0x1a, 0x1a, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x01, 0x01, 0x01, 0x00, 0x00, 0x00, 0x1e, 0x1e,
+ 0x08, 0x08, 0x13, 0x13, 0x13, 0x13, 0x13, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+ 0x18, 0x18, 0x00, 0x00, 0x22, 0x22, 0x09, 0x09,
+ 0x09, 0x00, 0x00, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x00, 0x00, 0x16, 0x16, 0x00,
+ 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 80 - BF
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ // Entry C0 - FF
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+ // Entry 100 - 13F
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04,
+ 0x08, 0x08, 0x00, 0x00, 0x01, 0x01, 0x01, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x04, 0x04, 0x0c, 0x0c,
+ 0x08, 0x08, 0x08, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ // Entry 140 - 17F
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+ 0x02, 0x02, 0x08, 0x08, 0x04, 0x04, 0x1f, 0x1f,
+ 0x14, 0x14, 0x04, 0x04, 0x08, 0x08, 0x08, 0x08,
+ 0x01, 0x01, 0x06, 0x00, 0x00, 0x20, 0x20, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x17, 0x17, 0x01,
+ 0x01, 0x13, 0x13, 0x13, 0x16, 0x16, 0x08, 0x08,
+ 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x04, 0x0a, 0x0a, 0x04, 0x04, 0x04, 0x04,
+ 0x04, 0x10, 0x17, 0x00, 0x00, 0x00, 0x08, 0x08,
+ 0x04, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x02,
+ 0x02, 0x08, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x01,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08,
+ 0x08, 0x08, 0x00, 0x00, 0x0f, 0x0f, 0x08, 0x10,
+ // Entry 1C0 - 1FF
+ 0x10, 0x08, 0x08, 0x0e, 0x0e, 0x08, 0x08, 0x08,
+ 0x08, 0x00, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x1b, 0x1b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0d, 0x0d, 0x08,
+ 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06,
+ 0x00, 0x00, 0x08, 0x08, 0x0b, 0x0b, 0x08, 0x08,
+ 0x08, 0x08, 0x12, 0x01, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x1c, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x00, 0x08, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08,
+ 0x08, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00,
+ 0x00, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, 0x08,
+ 0x06, 0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x08, 0x19, 0x19, 0x0d, 0x0d,
+ 0x08, 0x08, 0x03, 0x04, 0x03, 0x04, 0x04, 0x04,
+ // Entry 240 - 27F
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00,
+ 0x00, 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x12,
+ 0x12, 0x12, 0x08, 0x08, 0x1d, 0x1d, 0x1d, 0x1d,
+ 0x1d, 0x1d, 0x1d, 0x00, 0x00, 0x08, 0x08, 0x00,
+ 0x00, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x08,
+ 0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x00, 0x00,
+ 0x00, 0x00, 0x13, 0x11, 0x11, 0x11, 0x11, 0x11,
+ 0x05, 0x05, 0x18, 0x18, 0x15, 0x15, 0x10, 0x10,
+ // Entry 280 - 2BF
+ 0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x13,
+ 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13,
+ 0x13, 0x13, 0x08, 0x08, 0x08, 0x04, 0x04, 0x04,
+ 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08, 0x08,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+ 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x06,
+ 0x08, 0x08, 0x08, 0x0c, 0x08, 0x00, 0x00, 0x08,
+ // Entry 2C0 - 2FF
+ 0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x07,
+ 0x07, 0x08, 0x08, 0x1d, 0x1d, 0x04, 0x04, 0x04,
+ 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x08,
+ 0x08, 0x08, 0x08, 0x06, 0x08, 0x08, 0x00, 0x00,
+ 0x08, 0x08, 0x08, 0x00, 0x00, 0x04, 0x04, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x01, 0x01, 0x04, 0x04,
+} // Size: 799 bytes
+
+var cardinalInclusionMasks = []uint64{ // 100 elements
+ // Entry 0 - 1F
+ 0x0000000200500419, 0x0000000000512153, 0x000000000a327105, 0x0000000ca23c7101,
+ 0x00000004a23c7201, 0x0000000482943001, 0x0000001482943201, 0x0000000502943001,
+ 0x0000000502943001, 0x0000000522943201, 0x0000000540543401, 0x00000000454128e1,
+ 0x000000005b02e821, 0x000000006304e821, 0x000000006304ea21, 0x0000000042842821,
+ 0x0000000042842a21, 0x0000000042842821, 0x0000000042842821, 0x0000000062842a21,
+ 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021,
+ 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021,
+ 0x0000000002800021, 0x0000000022800221, 0x0000000000400421, 0x0000000000400061,
+ // Entry 20 - 3F
+ 0x000000000a004021, 0x0000000022004021, 0x0000000022004221, 0x0000000002800021,
+ 0x0000000002800221, 0x0000000002800021, 0x0000000002800021, 0x0000000022800221,
+ 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021,
+ 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021,
+ 0x0000000002800021, 0x0000000022800221, 0x0000000000400421, 0x0000000000400061,
+ 0x000000000a004021, 0x0000000022004021, 0x0000000022004221, 0x0000000002800021,
+ 0x0000000002800221, 0x0000000002800021, 0x0000000002800021, 0x0000000022800221,
+ 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021,
+ // Entry 40 - 5F
+ 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021,
+ 0x0000000002800021, 0x0000000022800221, 0x0000000040400421, 0x0000000044400061,
+ 0x000000005a004021, 0x0000000062004021, 0x0000000062004221, 0x0000000042800021,
+ 0x0000000042800221, 0x0000000042800021, 0x0000000042800021, 0x0000000062800221,
+ 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021,
+ 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021,
+ 0x0000000002800021, 0x0000000022800221, 0x0000000040400421, 0x0000000044400061,
+ 0x000000005a004021, 0x0000000062004021, 0x0000000062004221, 0x0000000042800021,
+ // Entry 60 - 7F
+ 0x0000000042800221, 0x0000000042800021, 0x0000000042800021, 0x0000000062800221,
+} // Size: 824 bytes
+
+// Slots used for cardinal: A6 of 0xFF rules; 24 of 0xFF indexes; 37 of 64 sets
+
+// Total table size 3860 bytes (3KiB); checksum: AAFBF21
diff --git a/vendor/golang.org/x/text/internal/catmsg/catmsg.go b/vendor/golang.org/x/text/internal/catmsg/catmsg.go
new file mode 100644
index 000000000..1b257a7b4
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/catmsg/catmsg.go
@@ -0,0 +1,417 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package catmsg contains support types for package x/text/message/catalog.
+//
+// This package contains the low-level implementations of Message used by the
+// catalog package and provides primitives for other packages to implement their
+// own. For instance, the plural package provides functionality for selecting
+// translation strings based on the plural category of substitution arguments.
+//
+// # Encoding and Decoding
+//
+// Catalogs store Messages encoded as a single string. Compiling a message into
+// a string both results in compacter representation and speeds up evaluation.
+//
+// A Message must implement a Compile method to convert its arbitrary
+// representation to a string. The Compile method takes an Encoder which
+// facilitates serializing the message. Encoders also provide more context of
+// the messages's creation (such as for which language the message is intended),
+// which may not be known at the time of the creation of the message.
+//
+// Each message type must also have an accompanying decoder registered to decode
+// the message. This decoder takes a Decoder argument which provides the
+// counterparts for the decoding.
+//
+// # Renderers
+//
+// A Decoder must be initialized with a Renderer implementation. These
+// implementations must be provided by packages that use Catalogs, typically
+// formatting packages such as x/text/message. A typical user will not need to
+// worry about this type; it is only relevant to packages that do string
+// formatting and want to use the catalog package to handle localized strings.
+//
+// A package that uses catalogs for selecting strings receives selection results
+// as sequence of substrings passed to the Renderer. The following snippet shows
+// how to express the above example using the message package.
+//
+// message.Set(language.English, "You are %d minute(s) late.",
+// catalog.Var("minutes", plural.Select(1, "one", "minute")),
+// catalog.String("You are %[1]d ${minutes} late."))
+//
+// p := message.NewPrinter(language.English)
+// p.Printf("You are %d minute(s) late.", 5) // always 5 minutes late.
+//
+// To evaluate the Printf, package message wraps the arguments in a Renderer
+// that is passed to the catalog for message decoding. The call sequence that
+// results from evaluating the above message, assuming the person is rather
+// tardy, is:
+//
+// Render("You are %[1]d ")
+// Arg(1)
+// Render("minutes")
+// Render(" late.")
+//
+// The calls to Arg is caused by the plural.Select execution, which evaluates
+// the argument to determine whether the singular or plural message form should
+// be selected. The calls to Render reports the partial results to the message
+// package for further evaluation.
+package catmsg
+
+import (
+ "errors"
+ "fmt"
+ "strconv"
+ "strings"
+ "sync"
+
+ "golang.org/x/text/language"
+)
+
+// A Handle refers to a registered message type.
+type Handle int
+
+// A Handler decodes and evaluates data compiled by a Message and sends the
+// result to the Decoder. The output may depend on the value of the substitution
+// arguments, accessible by the Decoder's Arg method. The Handler returns false
+// if there is no translation for the given substitution arguments.
+type Handler func(d *Decoder) bool
+
+// Register records the existence of a message type and returns a Handle that
+// can be used in the Encoder's EncodeMessageType method to create such
+// messages. The prefix of the name should be the package path followed by
+// an optional disambiguating string.
+// Register will panic if a handle for the same name was already registered.
+func Register(name string, handler Handler) Handle {
+ mutex.Lock()
+ defer mutex.Unlock()
+
+ if _, ok := names[name]; ok {
+ panic(fmt.Errorf("catmsg: handler for %q already exists", name))
+ }
+ h := Handle(len(handlers))
+ names[name] = h
+ handlers = append(handlers, handler)
+ return h
+}
+
+// These handlers require fixed positions in the handlers slice.
+const (
+ msgVars Handle = iota
+ msgFirst
+ msgRaw
+ msgString
+ msgAffix
+ // Leave some arbitrary room for future expansion: 20 should suffice.
+ numInternal = 20
+)
+
+const prefix = "golang.org/x/text/internal/catmsg."
+
+var (
+ // TODO: find a more stable way to link handles to message types.
+ mutex sync.Mutex
+ names = map[string]Handle{
+ prefix + "Vars": msgVars,
+ prefix + "First": msgFirst,
+ prefix + "Raw": msgRaw,
+ prefix + "String": msgString,
+ prefix + "Affix": msgAffix,
+ }
+ handlers = make([]Handler, numInternal)
+)
+
+func init() {
+ // This handler is a message type wrapper that initializes a decoder
+ // with a variable block. This message type, if present, is always at the
+ // start of an encoded message.
+ handlers[msgVars] = func(d *Decoder) bool {
+ blockSize := int(d.DecodeUint())
+ d.vars = d.data[:blockSize]
+ d.data = d.data[blockSize:]
+ return d.executeMessage()
+ }
+
+ // First takes the first message in a sequence that results in a match for
+ // the given substitution arguments.
+ handlers[msgFirst] = func(d *Decoder) bool {
+ for !d.Done() {
+ if d.ExecuteMessage() {
+ return true
+ }
+ }
+ return false
+ }
+
+ handlers[msgRaw] = func(d *Decoder) bool {
+ d.Render(d.data)
+ return true
+ }
+
+ // A String message alternates between a string constant and a variable
+ // substitution.
+ handlers[msgString] = func(d *Decoder) bool {
+ for !d.Done() {
+ if str := d.DecodeString(); str != "" {
+ d.Render(str)
+ }
+ if d.Done() {
+ break
+ }
+ d.ExecuteSubstitution()
+ }
+ return true
+ }
+
+ handlers[msgAffix] = func(d *Decoder) bool {
+ // TODO: use an alternative method for common cases.
+ prefix := d.DecodeString()
+ suffix := d.DecodeString()
+ if prefix != "" {
+ d.Render(prefix)
+ }
+ ret := d.ExecuteMessage()
+ if suffix != "" {
+ d.Render(suffix)
+ }
+ return ret
+ }
+}
+
+var (
+ // ErrIncomplete indicates a compiled message does not define translations
+ // for all possible argument values. If this message is returned, evaluating
+ // a message may result in the ErrNoMatch error.
+ ErrIncomplete = errors.New("catmsg: incomplete message; may not give result for all inputs")
+
+ // ErrNoMatch indicates no translation message matched the given input
+ // parameters when evaluating a message.
+ ErrNoMatch = errors.New("catmsg: no translation for inputs")
+)
+
+// A Message holds a collection of translations for the same phrase that may
+// vary based on the values of substitution arguments.
+type Message interface {
+ // Compile encodes the format string(s) of the message as a string for later
+ // evaluation.
+ //
+ // The first call Compile makes on the encoder must be EncodeMessageType.
+ // The handle passed to this call may either be a handle returned by
+ // Register to encode a single custom message, or HandleFirst followed by
+ // a sequence of calls to EncodeMessage.
+ //
+ // Compile must return ErrIncomplete if it is possible for evaluation to
+ // not match any translation for a given set of formatting parameters.
+ // For example, selecting a translation based on plural form may not yield
+ // a match if the form "Other" is not one of the selectors.
+ //
+ // Compile may return any other application-specific error. For backwards
+ // compatibility with package like fmt, which often do not do sanity
+ // checking of format strings ahead of time, Compile should still make an
+ // effort to have some sensible fallback in case of an error.
+ Compile(e *Encoder) error
+}
+
+// Compile converts a Message to a data string that can be stored in a Catalog.
+// The resulting string can subsequently be decoded by passing to the Execute
+// method of a Decoder.
+func Compile(tag language.Tag, macros Dictionary, m Message) (data string, err error) {
+ // TODO: pass macros so they can be used for validation.
+ v := &Encoder{inBody: true} // encoder for variables
+ v.root = v
+ e := &Encoder{root: v, parent: v, tag: tag} // encoder for messages
+ err = m.Compile(e)
+ // This package serves te message package, which in turn is meant to be a
+ // drop-in replacement for fmt. With the fmt package, format strings are
+ // evaluated lazily and errors are handled by substituting strings in the
+ // result, rather then returning an error. Dealing with multiple languages
+ // makes it more important to check errors ahead of time. We chose to be
+ // consistent and compatible and allow graceful degradation in case of
+ // errors.
+ buf := e.buf[stripPrefix(e.buf):]
+ if len(v.buf) > 0 {
+ // Prepend variable block.
+ b := make([]byte, 1+maxVarintBytes+len(v.buf)+len(buf))
+ b[0] = byte(msgVars)
+ b = b[:1+encodeUint(b[1:], uint64(len(v.buf)))]
+ b = append(b, v.buf...)
+ b = append(b, buf...)
+ buf = b
+ }
+ if err == nil {
+ err = v.err
+ }
+ return string(buf), err
+}
+
+// FirstOf is a message type that prints the first message in the sequence that
+// resolves to a match for the given substitution arguments.
+type FirstOf []Message
+
+// Compile implements Message.
+func (s FirstOf) Compile(e *Encoder) error {
+ e.EncodeMessageType(msgFirst)
+ err := ErrIncomplete
+ for i, m := range s {
+ if err == nil {
+ return fmt.Errorf("catalog: message argument %d is complete and blocks subsequent messages", i-1)
+ }
+ err = e.EncodeMessage(m)
+ }
+ return err
+}
+
+// Var defines a message that can be substituted for a placeholder of the same
+// name. If an expression does not result in a string after evaluation, Name is
+// used as the substitution. For example:
+//
+// Var{
+// Name: "minutes",
+// Message: plural.Select(1, "one", "minute"),
+// }
+//
+// will resolve to minute for singular and minutes for plural forms.
+type Var struct {
+ Name string
+ Message Message
+}
+
+var errIsVar = errors.New("catmsg: variable used as message")
+
+// Compile implements Message.
+//
+// Note that this method merely registers a variable; it does not create an
+// encoded message.
+func (v *Var) Compile(e *Encoder) error {
+ if err := e.addVar(v.Name, v.Message); err != nil {
+ return err
+ }
+ // Using a Var by itself is an error. If it is in a sequence followed by
+ // other messages referring to it, this error will be ignored.
+ return errIsVar
+}
+
+// Raw is a message consisting of a single format string that is passed as is
+// to the Renderer.
+//
+// Note that a Renderer may still do its own variable substitution.
+type Raw string
+
+// Compile implements Message.
+func (r Raw) Compile(e *Encoder) (err error) {
+ e.EncodeMessageType(msgRaw)
+ // Special case: raw strings don't have a size encoding and so don't use
+ // EncodeString.
+ e.buf = append(e.buf, r...)
+ return nil
+}
+
+// String is a message consisting of a single format string which contains
+// placeholders that may be substituted with variables.
+//
+// Variable substitutions are marked with placeholders and a variable name of
+// the form ${name}. Any other substitutions such as Go templates or
+// printf-style substitutions are left to be done by the Renderer.
+//
+// When evaluation a string interpolation, a Renderer will receive separate
+// calls for each placeholder and interstitial string. For example, for the
+// message: "%[1]v ${invites} %[2]v to ${their} party." The sequence of calls
+// is:
+//
+// d.Render("%[1]v ")
+// d.Arg(1)
+// d.Render(resultOfInvites)
+// d.Render(" %[2]v to ")
+// d.Arg(2)
+// d.Render(resultOfTheir)
+// d.Render(" party.")
+//
+// where the messages for "invites" and "their" both use a plural.Select
+// referring to the first argument.
+//
+// Strings may also invoke macros. Macros are essentially variables that can be
+// reused. Macros may, for instance, be used to make selections between
+// different conjugations of a verb. See the catalog package description for an
+// overview of macros.
+type String string
+
+// Compile implements Message. It parses the placeholder formats and returns
+// any error.
+func (s String) Compile(e *Encoder) (err error) {
+ msg := string(s)
+ const subStart = "${"
+ hasHeader := false
+ p := 0
+ b := []byte{}
+ for {
+ i := strings.Index(msg[p:], subStart)
+ if i == -1 {
+ break
+ }
+ b = append(b, msg[p:p+i]...)
+ p += i + len(subStart)
+ if i = strings.IndexByte(msg[p:], '}'); i == -1 {
+ b = append(b, "$!(MISSINGBRACE)"...)
+ err = fmt.Errorf("catmsg: missing '}'")
+ p = len(msg)
+ break
+ }
+ name := strings.TrimSpace(msg[p : p+i])
+ if q := strings.IndexByte(name, '('); q == -1 {
+ if !hasHeader {
+ hasHeader = true
+ e.EncodeMessageType(msgString)
+ }
+ e.EncodeString(string(b))
+ e.EncodeSubstitution(name)
+ b = b[:0]
+ } else if j := strings.IndexByte(name[q:], ')'); j == -1 {
+ // TODO: what should the error be?
+ b = append(b, "$!(MISSINGPAREN)"...)
+ err = fmt.Errorf("catmsg: missing ')'")
+ } else if x, sErr := strconv.ParseUint(strings.TrimSpace(name[q+1:q+j]), 10, 32); sErr != nil {
+ // TODO: handle more than one argument
+ b = append(b, "$!(BADNUM)"...)
+ err = fmt.Errorf("catmsg: invalid number %q", strings.TrimSpace(name[q+1:q+j]))
+ } else {
+ if !hasHeader {
+ hasHeader = true
+ e.EncodeMessageType(msgString)
+ }
+ e.EncodeString(string(b))
+ e.EncodeSubstitution(name[:q], int(x))
+ b = b[:0]
+ }
+ p += i + 1
+ }
+ b = append(b, msg[p:]...)
+ if !hasHeader {
+ // Simplify string to a raw string.
+ Raw(string(b)).Compile(e)
+ } else if len(b) > 0 {
+ e.EncodeString(string(b))
+ }
+ return err
+}
+
+// Affix is a message that adds a prefix and suffix to another message.
+// This is mostly used add back whitespace to a translation that was stripped
+// before sending it out.
+type Affix struct {
+ Message Message
+ Prefix string
+ Suffix string
+}
+
+// Compile implements Message.
+func (a Affix) Compile(e *Encoder) (err error) {
+ // TODO: consider adding a special message type that just adds a single
+ // return. This is probably common enough to handle the majority of cases.
+ // Get some stats first, though.
+ e.EncodeMessageType(msgAffix)
+ e.EncodeString(a.Prefix)
+ e.EncodeString(a.Suffix)
+ e.EncodeMessage(a.Message)
+ return nil
+}
diff --git a/vendor/golang.org/x/text/internal/catmsg/codec.go b/vendor/golang.org/x/text/internal/catmsg/codec.go
new file mode 100644
index 000000000..49c9fc978
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/catmsg/codec.go
@@ -0,0 +1,407 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package catmsg
+
+import (
+ "errors"
+ "fmt"
+
+ "golang.org/x/text/language"
+)
+
+// A Renderer renders a Message.
+type Renderer interface {
+ // Render renders the given string. The given string may be interpreted as a
+ // format string, such as the one used by the fmt package or a template.
+ Render(s string)
+
+ // Arg returns the i-th argument passed to format a message. This method
+ // should return nil if there is no such argument. Messages need access to
+ // arguments to allow selecting a message based on linguistic features of
+ // those arguments.
+ Arg(i int) interface{}
+}
+
+// A Dictionary specifies a source of messages, including variables or macros.
+type Dictionary interface {
+ // Lookup returns the message for the given key. It returns false for ok if
+ // such a message could not be found.
+ Lookup(key string) (data string, ok bool)
+
+ // TODO: consider returning an interface, instead of a string. This will
+ // allow implementations to do their own message type decoding.
+}
+
+// An Encoder serializes a Message to a string.
+type Encoder struct {
+ // The root encoder is used for storing encoded variables.
+ root *Encoder
+ // The parent encoder provides the surrounding scopes for resolving variable
+ // names.
+ parent *Encoder
+
+ tag language.Tag
+
+ // buf holds the encoded message so far. After a message completes encoding,
+ // the contents of buf, prefixed by the encoded length, are flushed to the
+ // parent buffer.
+ buf []byte
+
+ // vars is the lookup table of variables in the current scope.
+ vars []keyVal
+
+ err error
+ inBody bool // if false next call must be EncodeMessageType
+}
+
+type keyVal struct {
+ key string
+ offset int
+}
+
+// Language reports the language for which the encoded message will be stored
+// in the Catalog.
+func (e *Encoder) Language() language.Tag { return e.tag }
+
+func (e *Encoder) setError(err error) {
+ if e.root.err == nil {
+ e.root.err = err
+ }
+}
+
+// EncodeUint encodes x.
+func (e *Encoder) EncodeUint(x uint64) {
+ e.checkInBody()
+ var buf [maxVarintBytes]byte
+ n := encodeUint(buf[:], x)
+ e.buf = append(e.buf, buf[:n]...)
+}
+
+// EncodeString encodes s.
+func (e *Encoder) EncodeString(s string) {
+ e.checkInBody()
+ e.EncodeUint(uint64(len(s)))
+ e.buf = append(e.buf, s...)
+}
+
+// EncodeMessageType marks the current message to be of type h.
+//
+// It must be the first call of a Message's Compile method.
+func (e *Encoder) EncodeMessageType(h Handle) {
+ if e.inBody {
+ panic("catmsg: EncodeMessageType not the first method called")
+ }
+ e.inBody = true
+ e.EncodeUint(uint64(h))
+}
+
+// EncodeMessage serializes the given message inline at the current position.
+func (e *Encoder) EncodeMessage(m Message) error {
+ e = &Encoder{root: e.root, parent: e, tag: e.tag}
+ err := m.Compile(e)
+ if _, ok := m.(*Var); !ok {
+ e.flushTo(e.parent)
+ }
+ return err
+}
+
+func (e *Encoder) checkInBody() {
+ if !e.inBody {
+ panic("catmsg: expected prior call to EncodeMessageType")
+ }
+}
+
+// stripPrefix indicates the number of prefix bytes that must be stripped to
+// turn a single-element sequence into a message that is just this single member
+// without its size prefix. If the message can be stripped, b[1:n] contains the
+// size prefix.
+func stripPrefix(b []byte) (n int) {
+ if len(b) > 0 && Handle(b[0]) == msgFirst {
+ x, n, _ := decodeUint(b[1:])
+ if 1+n+int(x) == len(b) {
+ return 1 + n
+ }
+ }
+ return 0
+}
+
+func (e *Encoder) flushTo(dst *Encoder) {
+ data := e.buf
+ p := stripPrefix(data)
+ if p > 0 {
+ data = data[1:]
+ } else {
+ // Prefix the size.
+ dst.EncodeUint(uint64(len(data)))
+ }
+ dst.buf = append(dst.buf, data...)
+}
+
+func (e *Encoder) addVar(key string, m Message) error {
+ for _, v := range e.parent.vars {
+ if v.key == key {
+ err := fmt.Errorf("catmsg: duplicate variable %q", key)
+ e.setError(err)
+ return err
+ }
+ }
+ scope := e.parent
+ // If a variable message is Incomplete, and does not evaluate to a message
+ // during execution, we fall back to the variable name. We encode this by
+ // appending the variable name if the message reports it's incomplete.
+
+ err := m.Compile(e)
+ if err != ErrIncomplete {
+ e.setError(err)
+ }
+ switch {
+ case len(e.buf) == 1 && Handle(e.buf[0]) == msgFirst: // empty sequence
+ e.buf = e.buf[:0]
+ e.inBody = false
+ fallthrough
+ case len(e.buf) == 0:
+ // Empty message.
+ if err := String(key).Compile(e); err != nil {
+ e.setError(err)
+ }
+ case err == ErrIncomplete:
+ if Handle(e.buf[0]) != msgFirst {
+ seq := &Encoder{root: e.root, parent: e}
+ seq.EncodeMessageType(msgFirst)
+ e.flushTo(seq)
+ e = seq
+ }
+ // e contains a sequence; append the fallback string.
+ e.EncodeMessage(String(key))
+ }
+
+ // Flush result to variable heap.
+ offset := len(e.root.buf)
+ e.flushTo(e.root)
+ e.buf = e.buf[:0]
+
+ // Record variable offset in current scope.
+ scope.vars = append(scope.vars, keyVal{key: key, offset: offset})
+ return err
+}
+
+const (
+ substituteVar = iota
+ substituteMacro
+ substituteError
+)
+
+// EncodeSubstitution inserts a resolved reference to a variable or macro.
+//
+// This call must be matched with a call to ExecuteSubstitution at decoding
+// time.
+func (e *Encoder) EncodeSubstitution(name string, arguments ...int) {
+ if arity := len(arguments); arity > 0 {
+ // TODO: also resolve macros.
+ e.EncodeUint(substituteMacro)
+ e.EncodeString(name)
+ for _, a := range arguments {
+ e.EncodeUint(uint64(a))
+ }
+ return
+ }
+ for scope := e; scope != nil; scope = scope.parent {
+ for _, v := range scope.vars {
+ if v.key != name {
+ continue
+ }
+ e.EncodeUint(substituteVar) // TODO: support arity > 0
+ e.EncodeUint(uint64(v.offset))
+ return
+ }
+ }
+ // TODO: refer to dictionary-wide scoped variables.
+ e.EncodeUint(substituteError)
+ e.EncodeString(name)
+ e.setError(fmt.Errorf("catmsg: unknown var %q", name))
+}
+
+// A Decoder deserializes and evaluates messages that are encoded by an encoder.
+type Decoder struct {
+ tag language.Tag
+ dst Renderer
+ macros Dictionary
+
+ err error
+ vars string
+ data string
+
+ macroArg int // TODO: allow more than one argument
+}
+
+// NewDecoder returns a new Decoder.
+//
+// Decoders are designed to be reused for multiple invocations of Execute.
+// Only one goroutine may call Execute concurrently.
+func NewDecoder(tag language.Tag, r Renderer, macros Dictionary) *Decoder {
+ return &Decoder{
+ tag: tag,
+ dst: r,
+ macros: macros,
+ }
+}
+
+func (d *Decoder) setError(err error) {
+ if d.err == nil {
+ d.err = err
+ }
+}
+
+// Language returns the language in which the message is being rendered.
+//
+// The destination language may be a child language of the language used for
+// encoding. For instance, a decoding language of "pt-PT"" is consistent with an
+// encoding language of "pt".
+func (d *Decoder) Language() language.Tag { return d.tag }
+
+// Done reports whether there are more bytes to process in this message.
+func (d *Decoder) Done() bool { return len(d.data) == 0 }
+
+// Render implements Renderer.
+func (d *Decoder) Render(s string) { d.dst.Render(s) }
+
+// Arg implements Renderer.
+//
+// During evaluation of macros, the argument positions may be mapped to
+// arguments that differ from the original call.
+func (d *Decoder) Arg(i int) interface{} {
+ if d.macroArg != 0 {
+ if i != 1 {
+ panic("catmsg: only macros with single argument supported")
+ }
+ i = d.macroArg
+ }
+ return d.dst.Arg(i)
+}
+
+// DecodeUint decodes a number that was encoded with EncodeUint and advances the
+// position.
+func (d *Decoder) DecodeUint() uint64 {
+ x, n, err := decodeUintString(d.data)
+ d.data = d.data[n:]
+ if err != nil {
+ d.setError(err)
+ }
+ return x
+}
+
+// DecodeString decodes a string that was encoded with EncodeString and advances
+// the position.
+func (d *Decoder) DecodeString() string {
+ size := d.DecodeUint()
+ s := d.data[:size]
+ d.data = d.data[size:]
+ return s
+}
+
+// SkipMessage skips the message at the current location and advances the
+// position.
+func (d *Decoder) SkipMessage() {
+ n := int(d.DecodeUint())
+ d.data = d.data[n:]
+}
+
+// Execute decodes and evaluates msg.
+//
+// Only one goroutine may call execute.
+func (d *Decoder) Execute(msg string) error {
+ d.err = nil
+ if !d.execute(msg) {
+ return ErrNoMatch
+ }
+ return d.err
+}
+
+func (d *Decoder) execute(msg string) bool {
+ saved := d.data
+ d.data = msg
+ ok := d.executeMessage()
+ d.data = saved
+ return ok
+}
+
+// executeMessageFromData is like execute, but also decodes a leading message
+// size and clips the given string accordingly.
+//
+// It reports the number of bytes consumed and whether a message was selected.
+func (d *Decoder) executeMessageFromData(s string) (n int, ok bool) {
+ saved := d.data
+ d.data = s
+ size := int(d.DecodeUint())
+ n = len(s) - len(d.data)
+ // Sanitize the setting. This allows skipping a size argument for
+ // RawString and method Done.
+ d.data = d.data[:size]
+ ok = d.executeMessage()
+ n += size - len(d.data)
+ d.data = saved
+ return n, ok
+}
+
+var errUnknownHandler = errors.New("catmsg: string contains unsupported handler")
+
+// executeMessage reads the handle id, initializes the decoder and executes the
+// message. It is assumed that all of d.data[d.p:] is the single message.
+func (d *Decoder) executeMessage() bool {
+ if d.Done() {
+ // We interpret no data as a valid empty message.
+ return true
+ }
+ handle := d.DecodeUint()
+
+ var fn Handler
+ mutex.Lock()
+ if int(handle) < len(handlers) {
+ fn = handlers[handle]
+ }
+ mutex.Unlock()
+ if fn == nil {
+ d.setError(errUnknownHandler)
+ d.execute(fmt.Sprintf("\x02$!(UNKNOWNMSGHANDLER=%#x)", handle))
+ return true
+ }
+ return fn(d)
+}
+
+// ExecuteMessage decodes and executes the message at the current position.
+func (d *Decoder) ExecuteMessage() bool {
+ n, ok := d.executeMessageFromData(d.data)
+ d.data = d.data[n:]
+ return ok
+}
+
+// ExecuteSubstitution executes the message corresponding to the substitution
+// as encoded by EncodeSubstitution.
+func (d *Decoder) ExecuteSubstitution() {
+ switch x := d.DecodeUint(); x {
+ case substituteVar:
+ offset := d.DecodeUint()
+ d.executeMessageFromData(d.vars[offset:])
+ case substituteMacro:
+ name := d.DecodeString()
+ data, ok := d.macros.Lookup(name)
+ old := d.macroArg
+ // TODO: support macros of arity other than 1.
+ d.macroArg = int(d.DecodeUint())
+ switch {
+ case !ok:
+ // TODO: detect this at creation time.
+ d.setError(fmt.Errorf("catmsg: undefined macro %q", name))
+ fallthrough
+ case !d.execute(data):
+ d.dst.Render(name) // fall back to macro name.
+ }
+ d.macroArg = old
+ case substituteError:
+ d.dst.Render(d.DecodeString())
+ default:
+ panic("catmsg: unreachable")
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/catmsg/varint.go b/vendor/golang.org/x/text/internal/catmsg/varint.go
new file mode 100644
index 000000000..a2cee2cf5
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/catmsg/varint.go
@@ -0,0 +1,62 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package catmsg
+
+// This file implements varint encoding analogous to the one in encoding/binary.
+// We need a string version of this function, so we add that here and then add
+// the rest for consistency.
+
+import "errors"
+
+var (
+ errIllegalVarint = errors.New("catmsg: illegal varint")
+ errVarintTooLarge = errors.New("catmsg: varint too large for uint64")
+)
+
+const maxVarintBytes = 10 // maximum length of a varint
+
+// encodeUint encodes x as a variable-sized integer into buf and returns the
+// number of bytes written. buf must be at least maxVarintBytes long
+func encodeUint(buf []byte, x uint64) (n int) {
+ for ; x > 127; n++ {
+ buf[n] = 0x80 | uint8(x&0x7F)
+ x >>= 7
+ }
+ buf[n] = uint8(x)
+ n++
+ return n
+}
+
+func decodeUintString(s string) (x uint64, size int, err error) {
+ i := 0
+ for shift := uint(0); shift < 64; shift += 7 {
+ if i >= len(s) {
+ return 0, i, errIllegalVarint
+ }
+ b := uint64(s[i])
+ i++
+ x |= (b & 0x7F) << shift
+ if b&0x80 == 0 {
+ return x, i, nil
+ }
+ }
+ return 0, i, errVarintTooLarge
+}
+
+func decodeUint(b []byte) (x uint64, size int, err error) {
+ i := 0
+ for shift := uint(0); shift < 64; shift += 7 {
+ if i >= len(b) {
+ return 0, i, errIllegalVarint
+ }
+ c := uint64(b[i])
+ i++
+ x |= (c & 0x7F) << shift
+ if c&0x80 == 0 {
+ return x, i, nil
+ }
+ }
+ return 0, i, errVarintTooLarge
+}
diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go
new file mode 100644
index 000000000..ee1c57a3c
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/format/format.go
@@ -0,0 +1,41 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package format contains types for defining language-specific formatting of
+// values.
+//
+// This package is internal now, but will eventually be exposed after the API
+// settles.
+package format // import "golang.org/x/text/internal/format"
+
+import (
+ "fmt"
+
+ "golang.org/x/text/language"
+)
+
+// State represents the printer state passed to custom formatters. It provides
+// access to the fmt.State interface and the sentence and language-related
+// context.
+type State interface {
+ fmt.State
+
+ // Language reports the requested language in which to render a message.
+ Language() language.Tag
+
+ // TODO: consider this and removing rune from the Format method in the
+ // Formatter interface.
+ //
+ // Verb returns the format variant to render, analogous to the types used
+ // in fmt. Use 'v' for the default or only variant.
+ // Verb() rune
+
+ // TODO: more info:
+ // - sentence context such as linguistic features passed by the translator.
+}
+
+// Formatter is analogous to fmt.Formatter.
+type Formatter interface {
+ Format(state State, verb rune)
+}
diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go
new file mode 100644
index 000000000..855aed71d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/format/parser.go
@@ -0,0 +1,358 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package format
+
+import (
+ "reflect"
+ "unicode/utf8"
+)
+
+// A Parser parses a format string. The result from the parse are set in the
+// struct fields.
+type Parser struct {
+ Verb rune
+
+ WidthPresent bool
+ PrecPresent bool
+ Minus bool
+ Plus bool
+ Sharp bool
+ Space bool
+ Zero bool
+
+ // For the formats %+v %#v, we set the plusV/sharpV flags
+ // and clear the plus/sharp flags since %+v and %#v are in effect
+ // different, flagless formats set at the top level.
+ PlusV bool
+ SharpV bool
+
+ HasIndex bool
+
+ Width int
+ Prec int // precision
+
+ // retain arguments across calls.
+ Args []interface{}
+ // retain current argument number across calls
+ ArgNum int
+
+ // reordered records whether the format string used argument reordering.
+ Reordered bool
+ // goodArgNum records whether the most recent reordering directive was valid.
+ goodArgNum bool
+
+ // position info
+ format string
+ startPos int
+ endPos int
+ Status Status
+}
+
+// Reset initializes a parser to scan format strings for the given args.
+func (p *Parser) Reset(args []interface{}) {
+ p.Args = args
+ p.ArgNum = 0
+ p.startPos = 0
+ p.Reordered = false
+}
+
+// Text returns the part of the format string that was parsed by the last call
+// to Scan. It returns the original substitution clause if the current scan
+// parsed a substitution.
+func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] }
+
+// SetFormat sets a new format string to parse. It does not reset the argument
+// count.
+func (p *Parser) SetFormat(format string) {
+ p.format = format
+ p.startPos = 0
+ p.endPos = 0
+}
+
+// Status indicates the result type of a call to Scan.
+type Status int
+
+const (
+ StatusText Status = iota
+ StatusSubstitution
+ StatusBadWidthSubstitution
+ StatusBadPrecSubstitution
+ StatusNoVerb
+ StatusBadArgNum
+ StatusMissingArg
+)
+
+// ClearFlags reset the parser to default behavior.
+func (p *Parser) ClearFlags() {
+ p.WidthPresent = false
+ p.PrecPresent = false
+ p.Minus = false
+ p.Plus = false
+ p.Sharp = false
+ p.Space = false
+ p.Zero = false
+
+ p.PlusV = false
+ p.SharpV = false
+
+ p.HasIndex = false
+}
+
+// Scan scans the next part of the format string and sets the status to
+// indicate whether it scanned a string literal, substitution or error.
+func (p *Parser) Scan() bool {
+ p.Status = StatusText
+ format := p.format
+ end := len(format)
+ if p.endPos >= end {
+ return false
+ }
+ afterIndex := false // previous item in format was an index like [3].
+
+ p.startPos = p.endPos
+ p.goodArgNum = true
+ i := p.startPos
+ for i < end && format[i] != '%' {
+ i++
+ }
+ if i > p.startPos {
+ p.endPos = i
+ return true
+ }
+ // Process one verb
+ i++
+
+ p.Status = StatusSubstitution
+
+ // Do we have flags?
+ p.ClearFlags()
+
+simpleFormat:
+ for ; i < end; i++ {
+ c := p.format[i]
+ switch c {
+ case '#':
+ p.Sharp = true
+ case '0':
+ p.Zero = !p.Minus // Only allow zero padding to the left.
+ case '+':
+ p.Plus = true
+ case '-':
+ p.Minus = true
+ p.Zero = false // Do not pad with zeros to the right.
+ case ' ':
+ p.Space = true
+ default:
+ // Fast path for common case of ascii lower case simple verbs
+ // without precision or width or argument indices.
+ if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) {
+ if c == 'v' {
+ // Go syntax
+ p.SharpV = p.Sharp
+ p.Sharp = false
+ // Struct-field syntax
+ p.PlusV = p.Plus
+ p.Plus = false
+ }
+ p.Verb = rune(c)
+ p.ArgNum++
+ p.endPos = i + 1
+ return true
+ }
+ // Format is more complex than simple flags and a verb or is malformed.
+ break simpleFormat
+ }
+ }
+
+ // Do we have an explicit argument index?
+ i, afterIndex = p.updateArgNumber(format, i)
+
+ // Do we have width?
+ if i < end && format[i] == '*' {
+ i++
+ p.Width, p.WidthPresent = p.intFromArg()
+
+ if !p.WidthPresent {
+ p.Status = StatusBadWidthSubstitution
+ }
+
+ // We have a negative width, so take its value and ensure
+ // that the minus flag is set
+ if p.Width < 0 {
+ p.Width = -p.Width
+ p.Minus = true
+ p.Zero = false // Do not pad with zeros to the right.
+ }
+ afterIndex = false
+ } else {
+ p.Width, p.WidthPresent, i = parsenum(format, i, end)
+ if afterIndex && p.WidthPresent { // "%[3]2d"
+ p.goodArgNum = false
+ }
+ }
+
+ // Do we have precision?
+ if i+1 < end && format[i] == '.' {
+ i++
+ if afterIndex { // "%[3].2d"
+ p.goodArgNum = false
+ }
+ i, afterIndex = p.updateArgNumber(format, i)
+ if i < end && format[i] == '*' {
+ i++
+ p.Prec, p.PrecPresent = p.intFromArg()
+ // Negative precision arguments don't make sense
+ if p.Prec < 0 {
+ p.Prec = 0
+ p.PrecPresent = false
+ }
+ if !p.PrecPresent {
+ p.Status = StatusBadPrecSubstitution
+ }
+ afterIndex = false
+ } else {
+ p.Prec, p.PrecPresent, i = parsenum(format, i, end)
+ if !p.PrecPresent {
+ p.Prec = 0
+ p.PrecPresent = true
+ }
+ }
+ }
+
+ if !afterIndex {
+ i, afterIndex = p.updateArgNumber(format, i)
+ }
+ p.HasIndex = afterIndex
+
+ if i >= end {
+ p.endPos = i
+ p.Status = StatusNoVerb
+ return true
+ }
+
+ verb, w := utf8.DecodeRuneInString(format[i:])
+ p.endPos = i + w
+ p.Verb = verb
+
+ switch {
+ case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec.
+ p.startPos = p.endPos - 1
+ p.Status = StatusText
+ case !p.goodArgNum:
+ p.Status = StatusBadArgNum
+ case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb.
+ p.Status = StatusMissingArg
+ p.ArgNum++
+ case verb == 'v':
+ // Go syntax
+ p.SharpV = p.Sharp
+ p.Sharp = false
+ // Struct-field syntax
+ p.PlusV = p.Plus
+ p.Plus = false
+ fallthrough
+ default:
+ p.ArgNum++
+ }
+ return true
+}
+
+// intFromArg gets the ArgNumth element of Args. On return, isInt reports
+// whether the argument has integer type.
+func (p *Parser) intFromArg() (num int, isInt bool) {
+ if p.ArgNum < len(p.Args) {
+ arg := p.Args[p.ArgNum]
+ num, isInt = arg.(int) // Almost always OK.
+ if !isInt {
+ // Work harder.
+ switch v := reflect.ValueOf(arg); v.Kind() {
+ case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+ n := v.Int()
+ if int64(int(n)) == n {
+ num = int(n)
+ isInt = true
+ }
+ case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr:
+ n := v.Uint()
+ if int64(n) >= 0 && uint64(int(n)) == n {
+ num = int(n)
+ isInt = true
+ }
+ default:
+ // Already 0, false.
+ }
+ }
+ p.ArgNum++
+ if tooLarge(num) {
+ num = 0
+ isInt = false
+ }
+ }
+ return
+}
+
+// parseArgNumber returns the value of the bracketed number, minus 1
+// (explicit argument numbers are one-indexed but we want zero-indexed).
+// The opening bracket is known to be present at format[0].
+// The returned values are the index, the number of bytes to consume
+// up to the closing paren, if present, and whether the number parsed
+// ok. The bytes to consume will be 1 if no closing paren is present.
+func parseArgNumber(format string) (index int, wid int, ok bool) {
+ // There must be at least 3 bytes: [n].
+ if len(format) < 3 {
+ return 0, 1, false
+ }
+
+ // Find closing bracket.
+ for i := 1; i < len(format); i++ {
+ if format[i] == ']' {
+ width, ok, newi := parsenum(format, 1, i)
+ if !ok || newi != i {
+ return 0, i + 1, false
+ }
+ return width - 1, i + 1, true // arg numbers are one-indexed and skip paren.
+ }
+ }
+ return 0, 1, false
+}
+
+// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in
+// argNum or the value of the bracketed integer that begins format[i:]. It also returns
+// the new value of i, that is, the index of the next byte of the format to process.
+func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) {
+ if len(format) <= i || format[i] != '[' {
+ return i, false
+ }
+ p.Reordered = true
+ index, wid, ok := parseArgNumber(format[i:])
+ if ok && 0 <= index && index < len(p.Args) {
+ p.ArgNum = index
+ return i + wid, true
+ }
+ p.goodArgNum = false
+ return i + wid, ok
+}
+
+// tooLarge reports whether the magnitude of the integer is
+// too large to be used as a formatting width or precision.
+func tooLarge(x int) bool {
+ const max int = 1e6
+ return x > max || x < -max
+}
+
+// parsenum converts ASCII to integer. num is 0 (and isnum is false) if no number present.
+func parsenum(s string, start, end int) (num int, isnum bool, newi int) {
+ if start >= end {
+ return 0, false, end
+ }
+ for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ {
+ if tooLarge(num) {
+ return 0, false, end // Overflow; crazy long number most likely.
+ }
+ num = num*10 + int(s[newi]-'0')
+ isnum = true
+ }
+ return
+}
diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go
new file mode 100644
index 000000000..3cddbbdda
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/internal.go
@@ -0,0 +1,49 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package internal contains non-exported functionality that are used by
+// packages in the text repository.
+package internal // import "golang.org/x/text/internal"
+
+import (
+ "sort"
+
+ "golang.org/x/text/language"
+)
+
+// SortTags sorts tags in place.
+func SortTags(tags []language.Tag) {
+ sort.Sort(sorter(tags))
+}
+
+type sorter []language.Tag
+
+func (s sorter) Len() int {
+ return len(s)
+}
+
+func (s sorter) Swap(i, j int) {
+ s[i], s[j] = s[j], s[i]
+}
+
+func (s sorter) Less(i, j int) bool {
+ return s[i].String() < s[j].String()
+}
+
+// UniqueTags sorts and filters duplicate tags in place and returns a slice with
+// only unique tags.
+func UniqueTags(tags []language.Tag) []language.Tag {
+ if len(tags) <= 1 {
+ return tags
+ }
+ SortTags(tags)
+ k := 0
+ for i := 1; i < len(tags); i++ {
+ if tags[k].String() < tags[i].String() {
+ k++
+ tags[k] = tags[i]
+ }
+ }
+ return tags[:k+1]
+}
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 000000000..cdfdb7497
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+ Deprecated AliasType = iota
+ Macro
+ Legacy
+
+ AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 000000000..46a001507
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+ if t.LangID > langNoIndexOffset {
+ return 0, false
+ }
+ cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+ cci |= CompactCoreInfo(t.ScriptID) << 12
+ cci |= CompactCoreInfo(t.RegionID)
+ return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+ return Tag{
+ LangID: Language(c >> 20),
+ RegionID: Region(c & 0x3ff),
+ ScriptID: Script(c>>12) & 0xff,
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 000000000..1b36935ef
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ return 0, false
+ }
+ i := sort.Search(len(coreTags), func(i int) bool {
+ return cci <= coreTags[i]
+ })
+ if i == len(coreTags) || coreTags[i] != cci {
+ return 0, false
+ }
+ return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+ return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+ if int(id) >= len(coreTags) {
+ return specialTags[int(id)-len(coreTags)]
+ }
+ return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+ tags := strings.Split(specialTagsStr, " ")
+ specialTags = make([]language.Tag, len(tags))
+ for i, t := range tags {
+ specialTags[i] = language.MustParse(t)
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 000000000..8c1b6666f
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+ // NOTE: exported tags will become part of the public API.
+ language ID
+ locale ID
+ full fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+ IsRoot() bool
+ Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+ if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+ if r, err := language.ParseRegion(region[:2]); err == nil {
+ tFull := t
+ t, _ = t.SetTypeForKey("rg", "")
+ // TODO: should we not consider "va" for the language tag?
+ var exact1, exact2 bool
+ tag.language, exact1 = FromTag(t)
+ t.RegionID = r
+ tag.locale, exact2 = FromTag(t)
+ if !exact1 || !exact2 {
+ tag.full = tFull
+ }
+ return tag
+ }
+ }
+ lang, ok := FromTag(t)
+ tag.language = lang
+ tag.locale = lang
+ if !ok {
+ tag.full = t
+ }
+ return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+ if t.full != nil {
+ return t.full.(language.Tag)
+ }
+ tag := t.language.Tag()
+ if t.language != t.locale {
+ loc := t.locale.Tag()
+ tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+ }
+ return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+ return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+ return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+ return t.full != nil ||
+ int(t.language) >= len(coreTags) ||
+ t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if t.full != nil {
+ return t.full.IsRoot()
+ }
+ return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.full != nil {
+ return Make(t.full.Parent())
+ }
+ if t.language != t.locale {
+ // Simulate stripping -u-rg-xxxxxx
+ return Tag{language: t.language, locale: t.language}
+ }
+ // TODO: use parent lookup table once cycle from internal package is
+ // removed. Probably by internalizing the table and declaring this fast
+ // enough.
+ // lang := compactID(internal.Parent(uint16(t.language)))
+ lang, _ := FromTag(t.language.Tag().Parent())
+ return Tag{language: lang, locale: lang}
+}
+
+// nextToken returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+ return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+ return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+ if t.full == nil {
+ return Tag{language: t.language, locale: t.language}
+ }
+ tt := t.Tag()
+ tt.SetTypeForKey("rg", "")
+ tt.SetTypeForKey("va", "")
+ return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+ rt := Tag{language: t.locale, locale: t.locale}
+ if t.full == nil {
+ return rt
+ }
+ b := language.Builder{}
+ tag := t.Tag()
+ // tag, _ = tag.SetTypeForKey("rg", "")
+ b.SetTag(t.locale.Tag())
+ if v := tag.Variants(); v != "" {
+ for _, v := range strings.Split(v, "-") {
+ b.AddVariant(v)
+ }
+ }
+ for _, e := range tag.Extensions() {
+ b.AddExt(e)
+ }
+ return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+ // TODO: perhaps give more frequent tags a lower index.
+ // TODO: we could make the indexes stable. This will excluded some
+ // possibilities for optimization, so don't do this quite yet.
+ exact = true
+
+ b, s, r := t.Raw()
+ if t.HasString() {
+ if t.IsPrivateUse() {
+ // We have no entries for user-defined tags.
+ return 0, false
+ }
+ hasExtra := false
+ if t.HasVariants() {
+ if t.HasExtensions() {
+ build := language.Builder{}
+ build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+ build.AddVariant(t.Variants())
+ exact = false
+ t = build.Make()
+ }
+ hasExtra = true
+ } else if _, ok := t.Extension('u'); ok {
+ // TODO: va may mean something else. Consider not considering it.
+ // Strip all but the 'va' entry.
+ old := t
+ variant := t.TypeForKey("va")
+ t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+ if variant != "" {
+ t, _ = t.SetTypeForKey("va", variant)
+ hasExtra = true
+ }
+ exact = old == t
+ } else {
+ exact = false
+ }
+ if hasExtra {
+ // We have some variants.
+ for i, s := range specialTags {
+ if s == t {
+ return ID(i + len(coreTags)), exact
+ }
+ }
+ exact = false
+ }
+ }
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ exact = false
+ if r != 0 && s == 0 {
+ // Deal with cases where an extra script is inserted for the region.
+ t, _ := t.Maximize()
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ for t = t.Parent(); t != root; t = t.Parent() {
+ // No variants specified: just compare core components.
+ // The key has the form lllssrrr, where l, s, and r are nibbles for
+ // respectively the langID, scriptID, and regionID.
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 000000000..8d810723c
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+ // Entry 0 - 3F
+ 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+ 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+ 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+ 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+ 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+ // Entry 40 - 7F
+ 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+ 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+ 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+ 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+ 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+ 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+ 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+ 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+ // Entry 80 - BF
+ 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+ // Entry C0 - FF
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+ 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+ 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+ // Entry 100 - 13F
+ 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+ 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+ 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+ 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ // Entry 140 - 17F
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+ 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+ 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+ 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+ 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+ 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+ // Entry 180 - 1BF
+ 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+ 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+ 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+ 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+ 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+ 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+ 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+ 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+ // Entry 1C0 - 1FF
+ 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+ 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+ 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+ 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+ 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+ 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+ 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+ 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+ // Entry 200 - 23F
+ 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+ 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+ 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+ 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+ 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+ 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+ 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+ 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+ // Entry 240 - 27F
+ 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+ 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+ 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+ 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+ 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+ 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+ 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+ 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+ // Entry 280 - 2BF
+ 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+ 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+ 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+ 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+ 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+ 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+ 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+ 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+ // Entry 2C0 - 2FF
+ 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+ 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+ 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+ 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+ 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+ 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+ 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+ 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+ // Entry 300 - 33F
+ 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 000000000..a09ed198a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+ undIndex ID = 0
+ afIndex ID = 1
+ afNAIndex ID = 2
+ afZAIndex ID = 3
+ agqIndex ID = 4
+ agqCMIndex ID = 5
+ akIndex ID = 6
+ akGHIndex ID = 7
+ amIndex ID = 8
+ amETIndex ID = 9
+ arIndex ID = 10
+ ar001Index ID = 11
+ arAEIndex ID = 12
+ arBHIndex ID = 13
+ arDJIndex ID = 14
+ arDZIndex ID = 15
+ arEGIndex ID = 16
+ arEHIndex ID = 17
+ arERIndex ID = 18
+ arILIndex ID = 19
+ arIQIndex ID = 20
+ arJOIndex ID = 21
+ arKMIndex ID = 22
+ arKWIndex ID = 23
+ arLBIndex ID = 24
+ arLYIndex ID = 25
+ arMAIndex ID = 26
+ arMRIndex ID = 27
+ arOMIndex ID = 28
+ arPSIndex ID = 29
+ arQAIndex ID = 30
+ arSAIndex ID = 31
+ arSDIndex ID = 32
+ arSOIndex ID = 33
+ arSSIndex ID = 34
+ arSYIndex ID = 35
+ arTDIndex ID = 36
+ arTNIndex ID = 37
+ arYEIndex ID = 38
+ arsIndex ID = 39
+ asIndex ID = 40
+ asINIndex ID = 41
+ asaIndex ID = 42
+ asaTZIndex ID = 43
+ astIndex ID = 44
+ astESIndex ID = 45
+ azIndex ID = 46
+ azCyrlIndex ID = 47
+ azCyrlAZIndex ID = 48
+ azLatnIndex ID = 49
+ azLatnAZIndex ID = 50
+ basIndex ID = 51
+ basCMIndex ID = 52
+ beIndex ID = 53
+ beBYIndex ID = 54
+ bemIndex ID = 55
+ bemZMIndex ID = 56
+ bezIndex ID = 57
+ bezTZIndex ID = 58
+ bgIndex ID = 59
+ bgBGIndex ID = 60
+ bhIndex ID = 61
+ bmIndex ID = 62
+ bmMLIndex ID = 63
+ bnIndex ID = 64
+ bnBDIndex ID = 65
+ bnINIndex ID = 66
+ boIndex ID = 67
+ boCNIndex ID = 68
+ boINIndex ID = 69
+ brIndex ID = 70
+ brFRIndex ID = 71
+ brxIndex ID = 72
+ brxINIndex ID = 73
+ bsIndex ID = 74
+ bsCyrlIndex ID = 75
+ bsCyrlBAIndex ID = 76
+ bsLatnIndex ID = 77
+ bsLatnBAIndex ID = 78
+ caIndex ID = 79
+ caADIndex ID = 80
+ caESIndex ID = 81
+ caFRIndex ID = 82
+ caITIndex ID = 83
+ ccpIndex ID = 84
+ ccpBDIndex ID = 85
+ ccpINIndex ID = 86
+ ceIndex ID = 87
+ ceRUIndex ID = 88
+ cggIndex ID = 89
+ cggUGIndex ID = 90
+ chrIndex ID = 91
+ chrUSIndex ID = 92
+ ckbIndex ID = 93
+ ckbIQIndex ID = 94
+ ckbIRIndex ID = 95
+ csIndex ID = 96
+ csCZIndex ID = 97
+ cuIndex ID = 98
+ cuRUIndex ID = 99
+ cyIndex ID = 100
+ cyGBIndex ID = 101
+ daIndex ID = 102
+ daDKIndex ID = 103
+ daGLIndex ID = 104
+ davIndex ID = 105
+ davKEIndex ID = 106
+ deIndex ID = 107
+ deATIndex ID = 108
+ deBEIndex ID = 109
+ deCHIndex ID = 110
+ deDEIndex ID = 111
+ deITIndex ID = 112
+ deLIIndex ID = 113
+ deLUIndex ID = 114
+ djeIndex ID = 115
+ djeNEIndex ID = 116
+ dsbIndex ID = 117
+ dsbDEIndex ID = 118
+ duaIndex ID = 119
+ duaCMIndex ID = 120
+ dvIndex ID = 121
+ dyoIndex ID = 122
+ dyoSNIndex ID = 123
+ dzIndex ID = 124
+ dzBTIndex ID = 125
+ ebuIndex ID = 126
+ ebuKEIndex ID = 127
+ eeIndex ID = 128
+ eeGHIndex ID = 129
+ eeTGIndex ID = 130
+ elIndex ID = 131
+ elCYIndex ID = 132
+ elGRIndex ID = 133
+ enIndex ID = 134
+ en001Index ID = 135
+ en150Index ID = 136
+ enAGIndex ID = 137
+ enAIIndex ID = 138
+ enASIndex ID = 139
+ enATIndex ID = 140
+ enAUIndex ID = 141
+ enBBIndex ID = 142
+ enBEIndex ID = 143
+ enBIIndex ID = 144
+ enBMIndex ID = 145
+ enBSIndex ID = 146
+ enBWIndex ID = 147
+ enBZIndex ID = 148
+ enCAIndex ID = 149
+ enCCIndex ID = 150
+ enCHIndex ID = 151
+ enCKIndex ID = 152
+ enCMIndex ID = 153
+ enCXIndex ID = 154
+ enCYIndex ID = 155
+ enDEIndex ID = 156
+ enDGIndex ID = 157
+ enDKIndex ID = 158
+ enDMIndex ID = 159
+ enERIndex ID = 160
+ enFIIndex ID = 161
+ enFJIndex ID = 162
+ enFKIndex ID = 163
+ enFMIndex ID = 164
+ enGBIndex ID = 165
+ enGDIndex ID = 166
+ enGGIndex ID = 167
+ enGHIndex ID = 168
+ enGIIndex ID = 169
+ enGMIndex ID = 170
+ enGUIndex ID = 171
+ enGYIndex ID = 172
+ enHKIndex ID = 173
+ enIEIndex ID = 174
+ enILIndex ID = 175
+ enIMIndex ID = 176
+ enINIndex ID = 177
+ enIOIndex ID = 178
+ enJEIndex ID = 179
+ enJMIndex ID = 180
+ enKEIndex ID = 181
+ enKIIndex ID = 182
+ enKNIndex ID = 183
+ enKYIndex ID = 184
+ enLCIndex ID = 185
+ enLRIndex ID = 186
+ enLSIndex ID = 187
+ enMGIndex ID = 188
+ enMHIndex ID = 189
+ enMOIndex ID = 190
+ enMPIndex ID = 191
+ enMSIndex ID = 192
+ enMTIndex ID = 193
+ enMUIndex ID = 194
+ enMWIndex ID = 195
+ enMYIndex ID = 196
+ enNAIndex ID = 197
+ enNFIndex ID = 198
+ enNGIndex ID = 199
+ enNLIndex ID = 200
+ enNRIndex ID = 201
+ enNUIndex ID = 202
+ enNZIndex ID = 203
+ enPGIndex ID = 204
+ enPHIndex ID = 205
+ enPKIndex ID = 206
+ enPNIndex ID = 207
+ enPRIndex ID = 208
+ enPWIndex ID = 209
+ enRWIndex ID = 210
+ enSBIndex ID = 211
+ enSCIndex ID = 212
+ enSDIndex ID = 213
+ enSEIndex ID = 214
+ enSGIndex ID = 215
+ enSHIndex ID = 216
+ enSIIndex ID = 217
+ enSLIndex ID = 218
+ enSSIndex ID = 219
+ enSXIndex ID = 220
+ enSZIndex ID = 221
+ enTCIndex ID = 222
+ enTKIndex ID = 223
+ enTOIndex ID = 224
+ enTTIndex ID = 225
+ enTVIndex ID = 226
+ enTZIndex ID = 227
+ enUGIndex ID = 228
+ enUMIndex ID = 229
+ enUSIndex ID = 230
+ enVCIndex ID = 231
+ enVGIndex ID = 232
+ enVIIndex ID = 233
+ enVUIndex ID = 234
+ enWSIndex ID = 235
+ enZAIndex ID = 236
+ enZMIndex ID = 237
+ enZWIndex ID = 238
+ eoIndex ID = 239
+ eo001Index ID = 240
+ esIndex ID = 241
+ es419Index ID = 242
+ esARIndex ID = 243
+ esBOIndex ID = 244
+ esBRIndex ID = 245
+ esBZIndex ID = 246
+ esCLIndex ID = 247
+ esCOIndex ID = 248
+ esCRIndex ID = 249
+ esCUIndex ID = 250
+ esDOIndex ID = 251
+ esEAIndex ID = 252
+ esECIndex ID = 253
+ esESIndex ID = 254
+ esGQIndex ID = 255
+ esGTIndex ID = 256
+ esHNIndex ID = 257
+ esICIndex ID = 258
+ esMXIndex ID = 259
+ esNIIndex ID = 260
+ esPAIndex ID = 261
+ esPEIndex ID = 262
+ esPHIndex ID = 263
+ esPRIndex ID = 264
+ esPYIndex ID = 265
+ esSVIndex ID = 266
+ esUSIndex ID = 267
+ esUYIndex ID = 268
+ esVEIndex ID = 269
+ etIndex ID = 270
+ etEEIndex ID = 271
+ euIndex ID = 272
+ euESIndex ID = 273
+ ewoIndex ID = 274
+ ewoCMIndex ID = 275
+ faIndex ID = 276
+ faAFIndex ID = 277
+ faIRIndex ID = 278
+ ffIndex ID = 279
+ ffCMIndex ID = 280
+ ffGNIndex ID = 281
+ ffMRIndex ID = 282
+ ffSNIndex ID = 283
+ fiIndex ID = 284
+ fiFIIndex ID = 285
+ filIndex ID = 286
+ filPHIndex ID = 287
+ foIndex ID = 288
+ foDKIndex ID = 289
+ foFOIndex ID = 290
+ frIndex ID = 291
+ frBEIndex ID = 292
+ frBFIndex ID = 293
+ frBIIndex ID = 294
+ frBJIndex ID = 295
+ frBLIndex ID = 296
+ frCAIndex ID = 297
+ frCDIndex ID = 298
+ frCFIndex ID = 299
+ frCGIndex ID = 300
+ frCHIndex ID = 301
+ frCIIndex ID = 302
+ frCMIndex ID = 303
+ frDJIndex ID = 304
+ frDZIndex ID = 305
+ frFRIndex ID = 306
+ frGAIndex ID = 307
+ frGFIndex ID = 308
+ frGNIndex ID = 309
+ frGPIndex ID = 310
+ frGQIndex ID = 311
+ frHTIndex ID = 312
+ frKMIndex ID = 313
+ frLUIndex ID = 314
+ frMAIndex ID = 315
+ frMCIndex ID = 316
+ frMFIndex ID = 317
+ frMGIndex ID = 318
+ frMLIndex ID = 319
+ frMQIndex ID = 320
+ frMRIndex ID = 321
+ frMUIndex ID = 322
+ frNCIndex ID = 323
+ frNEIndex ID = 324
+ frPFIndex ID = 325
+ frPMIndex ID = 326
+ frREIndex ID = 327
+ frRWIndex ID = 328
+ frSCIndex ID = 329
+ frSNIndex ID = 330
+ frSYIndex ID = 331
+ frTDIndex ID = 332
+ frTGIndex ID = 333
+ frTNIndex ID = 334
+ frVUIndex ID = 335
+ frWFIndex ID = 336
+ frYTIndex ID = 337
+ furIndex ID = 338
+ furITIndex ID = 339
+ fyIndex ID = 340
+ fyNLIndex ID = 341
+ gaIndex ID = 342
+ gaIEIndex ID = 343
+ gdIndex ID = 344
+ gdGBIndex ID = 345
+ glIndex ID = 346
+ glESIndex ID = 347
+ gswIndex ID = 348
+ gswCHIndex ID = 349
+ gswFRIndex ID = 350
+ gswLIIndex ID = 351
+ guIndex ID = 352
+ guINIndex ID = 353
+ guwIndex ID = 354
+ guzIndex ID = 355
+ guzKEIndex ID = 356
+ gvIndex ID = 357
+ gvIMIndex ID = 358
+ haIndex ID = 359
+ haGHIndex ID = 360
+ haNEIndex ID = 361
+ haNGIndex ID = 362
+ hawIndex ID = 363
+ hawUSIndex ID = 364
+ heIndex ID = 365
+ heILIndex ID = 366
+ hiIndex ID = 367
+ hiINIndex ID = 368
+ hrIndex ID = 369
+ hrBAIndex ID = 370
+ hrHRIndex ID = 371
+ hsbIndex ID = 372
+ hsbDEIndex ID = 373
+ huIndex ID = 374
+ huHUIndex ID = 375
+ hyIndex ID = 376
+ hyAMIndex ID = 377
+ idIndex ID = 378
+ idIDIndex ID = 379
+ igIndex ID = 380
+ igNGIndex ID = 381
+ iiIndex ID = 382
+ iiCNIndex ID = 383
+ inIndex ID = 384
+ ioIndex ID = 385
+ isIndex ID = 386
+ isISIndex ID = 387
+ itIndex ID = 388
+ itCHIndex ID = 389
+ itITIndex ID = 390
+ itSMIndex ID = 391
+ itVAIndex ID = 392
+ iuIndex ID = 393
+ iwIndex ID = 394
+ jaIndex ID = 395
+ jaJPIndex ID = 396
+ jboIndex ID = 397
+ jgoIndex ID = 398
+ jgoCMIndex ID = 399
+ jiIndex ID = 400
+ jmcIndex ID = 401
+ jmcTZIndex ID = 402
+ jvIndex ID = 403
+ jwIndex ID = 404
+ kaIndex ID = 405
+ kaGEIndex ID = 406
+ kabIndex ID = 407
+ kabDZIndex ID = 408
+ kajIndex ID = 409
+ kamIndex ID = 410
+ kamKEIndex ID = 411
+ kcgIndex ID = 412
+ kdeIndex ID = 413
+ kdeTZIndex ID = 414
+ keaIndex ID = 415
+ keaCVIndex ID = 416
+ khqIndex ID = 417
+ khqMLIndex ID = 418
+ kiIndex ID = 419
+ kiKEIndex ID = 420
+ kkIndex ID = 421
+ kkKZIndex ID = 422
+ kkjIndex ID = 423
+ kkjCMIndex ID = 424
+ klIndex ID = 425
+ klGLIndex ID = 426
+ klnIndex ID = 427
+ klnKEIndex ID = 428
+ kmIndex ID = 429
+ kmKHIndex ID = 430
+ knIndex ID = 431
+ knINIndex ID = 432
+ koIndex ID = 433
+ koKPIndex ID = 434
+ koKRIndex ID = 435
+ kokIndex ID = 436
+ kokINIndex ID = 437
+ ksIndex ID = 438
+ ksINIndex ID = 439
+ ksbIndex ID = 440
+ ksbTZIndex ID = 441
+ ksfIndex ID = 442
+ ksfCMIndex ID = 443
+ kshIndex ID = 444
+ kshDEIndex ID = 445
+ kuIndex ID = 446
+ kwIndex ID = 447
+ kwGBIndex ID = 448
+ kyIndex ID = 449
+ kyKGIndex ID = 450
+ lagIndex ID = 451
+ lagTZIndex ID = 452
+ lbIndex ID = 453
+ lbLUIndex ID = 454
+ lgIndex ID = 455
+ lgUGIndex ID = 456
+ lktIndex ID = 457
+ lktUSIndex ID = 458
+ lnIndex ID = 459
+ lnAOIndex ID = 460
+ lnCDIndex ID = 461
+ lnCFIndex ID = 462
+ lnCGIndex ID = 463
+ loIndex ID = 464
+ loLAIndex ID = 465
+ lrcIndex ID = 466
+ lrcIQIndex ID = 467
+ lrcIRIndex ID = 468
+ ltIndex ID = 469
+ ltLTIndex ID = 470
+ luIndex ID = 471
+ luCDIndex ID = 472
+ luoIndex ID = 473
+ luoKEIndex ID = 474
+ luyIndex ID = 475
+ luyKEIndex ID = 476
+ lvIndex ID = 477
+ lvLVIndex ID = 478
+ masIndex ID = 479
+ masKEIndex ID = 480
+ masTZIndex ID = 481
+ merIndex ID = 482
+ merKEIndex ID = 483
+ mfeIndex ID = 484
+ mfeMUIndex ID = 485
+ mgIndex ID = 486
+ mgMGIndex ID = 487
+ mghIndex ID = 488
+ mghMZIndex ID = 489
+ mgoIndex ID = 490
+ mgoCMIndex ID = 491
+ mkIndex ID = 492
+ mkMKIndex ID = 493
+ mlIndex ID = 494
+ mlINIndex ID = 495
+ mnIndex ID = 496
+ mnMNIndex ID = 497
+ moIndex ID = 498
+ mrIndex ID = 499
+ mrINIndex ID = 500
+ msIndex ID = 501
+ msBNIndex ID = 502
+ msMYIndex ID = 503
+ msSGIndex ID = 504
+ mtIndex ID = 505
+ mtMTIndex ID = 506
+ muaIndex ID = 507
+ muaCMIndex ID = 508
+ myIndex ID = 509
+ myMMIndex ID = 510
+ mznIndex ID = 511
+ mznIRIndex ID = 512
+ nahIndex ID = 513
+ naqIndex ID = 514
+ naqNAIndex ID = 515
+ nbIndex ID = 516
+ nbNOIndex ID = 517
+ nbSJIndex ID = 518
+ ndIndex ID = 519
+ ndZWIndex ID = 520
+ ndsIndex ID = 521
+ ndsDEIndex ID = 522
+ ndsNLIndex ID = 523
+ neIndex ID = 524
+ neINIndex ID = 525
+ neNPIndex ID = 526
+ nlIndex ID = 527
+ nlAWIndex ID = 528
+ nlBEIndex ID = 529
+ nlBQIndex ID = 530
+ nlCWIndex ID = 531
+ nlNLIndex ID = 532
+ nlSRIndex ID = 533
+ nlSXIndex ID = 534
+ nmgIndex ID = 535
+ nmgCMIndex ID = 536
+ nnIndex ID = 537
+ nnNOIndex ID = 538
+ nnhIndex ID = 539
+ nnhCMIndex ID = 540
+ noIndex ID = 541
+ nqoIndex ID = 542
+ nrIndex ID = 543
+ nsoIndex ID = 544
+ nusIndex ID = 545
+ nusSSIndex ID = 546
+ nyIndex ID = 547
+ nynIndex ID = 548
+ nynUGIndex ID = 549
+ omIndex ID = 550
+ omETIndex ID = 551
+ omKEIndex ID = 552
+ orIndex ID = 553
+ orINIndex ID = 554
+ osIndex ID = 555
+ osGEIndex ID = 556
+ osRUIndex ID = 557
+ paIndex ID = 558
+ paArabIndex ID = 559
+ paArabPKIndex ID = 560
+ paGuruIndex ID = 561
+ paGuruINIndex ID = 562
+ papIndex ID = 563
+ plIndex ID = 564
+ plPLIndex ID = 565
+ prgIndex ID = 566
+ prg001Index ID = 567
+ psIndex ID = 568
+ psAFIndex ID = 569
+ ptIndex ID = 570
+ ptAOIndex ID = 571
+ ptBRIndex ID = 572
+ ptCHIndex ID = 573
+ ptCVIndex ID = 574
+ ptGQIndex ID = 575
+ ptGWIndex ID = 576
+ ptLUIndex ID = 577
+ ptMOIndex ID = 578
+ ptMZIndex ID = 579
+ ptPTIndex ID = 580
+ ptSTIndex ID = 581
+ ptTLIndex ID = 582
+ quIndex ID = 583
+ quBOIndex ID = 584
+ quECIndex ID = 585
+ quPEIndex ID = 586
+ rmIndex ID = 587
+ rmCHIndex ID = 588
+ rnIndex ID = 589
+ rnBIIndex ID = 590
+ roIndex ID = 591
+ roMDIndex ID = 592
+ roROIndex ID = 593
+ rofIndex ID = 594
+ rofTZIndex ID = 595
+ ruIndex ID = 596
+ ruBYIndex ID = 597
+ ruKGIndex ID = 598
+ ruKZIndex ID = 599
+ ruMDIndex ID = 600
+ ruRUIndex ID = 601
+ ruUAIndex ID = 602
+ rwIndex ID = 603
+ rwRWIndex ID = 604
+ rwkIndex ID = 605
+ rwkTZIndex ID = 606
+ sahIndex ID = 607
+ sahRUIndex ID = 608
+ saqIndex ID = 609
+ saqKEIndex ID = 610
+ sbpIndex ID = 611
+ sbpTZIndex ID = 612
+ sdIndex ID = 613
+ sdPKIndex ID = 614
+ sdhIndex ID = 615
+ seIndex ID = 616
+ seFIIndex ID = 617
+ seNOIndex ID = 618
+ seSEIndex ID = 619
+ sehIndex ID = 620
+ sehMZIndex ID = 621
+ sesIndex ID = 622
+ sesMLIndex ID = 623
+ sgIndex ID = 624
+ sgCFIndex ID = 625
+ shIndex ID = 626
+ shiIndex ID = 627
+ shiLatnIndex ID = 628
+ shiLatnMAIndex ID = 629
+ shiTfngIndex ID = 630
+ shiTfngMAIndex ID = 631
+ siIndex ID = 632
+ siLKIndex ID = 633
+ skIndex ID = 634
+ skSKIndex ID = 635
+ slIndex ID = 636
+ slSIIndex ID = 637
+ smaIndex ID = 638
+ smiIndex ID = 639
+ smjIndex ID = 640
+ smnIndex ID = 641
+ smnFIIndex ID = 642
+ smsIndex ID = 643
+ snIndex ID = 644
+ snZWIndex ID = 645
+ soIndex ID = 646
+ soDJIndex ID = 647
+ soETIndex ID = 648
+ soKEIndex ID = 649
+ soSOIndex ID = 650
+ sqIndex ID = 651
+ sqALIndex ID = 652
+ sqMKIndex ID = 653
+ sqXKIndex ID = 654
+ srIndex ID = 655
+ srCyrlIndex ID = 656
+ srCyrlBAIndex ID = 657
+ srCyrlMEIndex ID = 658
+ srCyrlRSIndex ID = 659
+ srCyrlXKIndex ID = 660
+ srLatnIndex ID = 661
+ srLatnBAIndex ID = 662
+ srLatnMEIndex ID = 663
+ srLatnRSIndex ID = 664
+ srLatnXKIndex ID = 665
+ ssIndex ID = 666
+ ssyIndex ID = 667
+ stIndex ID = 668
+ svIndex ID = 669
+ svAXIndex ID = 670
+ svFIIndex ID = 671
+ svSEIndex ID = 672
+ swIndex ID = 673
+ swCDIndex ID = 674
+ swKEIndex ID = 675
+ swTZIndex ID = 676
+ swUGIndex ID = 677
+ syrIndex ID = 678
+ taIndex ID = 679
+ taINIndex ID = 680
+ taLKIndex ID = 681
+ taMYIndex ID = 682
+ taSGIndex ID = 683
+ teIndex ID = 684
+ teINIndex ID = 685
+ teoIndex ID = 686
+ teoKEIndex ID = 687
+ teoUGIndex ID = 688
+ tgIndex ID = 689
+ tgTJIndex ID = 690
+ thIndex ID = 691
+ thTHIndex ID = 692
+ tiIndex ID = 693
+ tiERIndex ID = 694
+ tiETIndex ID = 695
+ tigIndex ID = 696
+ tkIndex ID = 697
+ tkTMIndex ID = 698
+ tlIndex ID = 699
+ tnIndex ID = 700
+ toIndex ID = 701
+ toTOIndex ID = 702
+ trIndex ID = 703
+ trCYIndex ID = 704
+ trTRIndex ID = 705
+ tsIndex ID = 706
+ ttIndex ID = 707
+ ttRUIndex ID = 708
+ twqIndex ID = 709
+ twqNEIndex ID = 710
+ tzmIndex ID = 711
+ tzmMAIndex ID = 712
+ ugIndex ID = 713
+ ugCNIndex ID = 714
+ ukIndex ID = 715
+ ukUAIndex ID = 716
+ urIndex ID = 717
+ urINIndex ID = 718
+ urPKIndex ID = 719
+ uzIndex ID = 720
+ uzArabIndex ID = 721
+ uzArabAFIndex ID = 722
+ uzCyrlIndex ID = 723
+ uzCyrlUZIndex ID = 724
+ uzLatnIndex ID = 725
+ uzLatnUZIndex ID = 726
+ vaiIndex ID = 727
+ vaiLatnIndex ID = 728
+ vaiLatnLRIndex ID = 729
+ vaiVaiiIndex ID = 730
+ vaiVaiiLRIndex ID = 731
+ veIndex ID = 732
+ viIndex ID = 733
+ viVNIndex ID = 734
+ voIndex ID = 735
+ vo001Index ID = 736
+ vunIndex ID = 737
+ vunTZIndex ID = 738
+ waIndex ID = 739
+ waeIndex ID = 740
+ waeCHIndex ID = 741
+ woIndex ID = 742
+ woSNIndex ID = 743
+ xhIndex ID = 744
+ xogIndex ID = 745
+ xogUGIndex ID = 746
+ yavIndex ID = 747
+ yavCMIndex ID = 748
+ yiIndex ID = 749
+ yi001Index ID = 750
+ yoIndex ID = 751
+ yoBJIndex ID = 752
+ yoNGIndex ID = 753
+ yueIndex ID = 754
+ yueHansIndex ID = 755
+ yueHansCNIndex ID = 756
+ yueHantIndex ID = 757
+ yueHantHKIndex ID = 758
+ zghIndex ID = 759
+ zghMAIndex ID = 760
+ zhIndex ID = 761
+ zhHansIndex ID = 762
+ zhHansCNIndex ID = 763
+ zhHansHKIndex ID = 764
+ zhHansMOIndex ID = 765
+ zhHansSGIndex ID = 766
+ zhHantIndex ID = 767
+ zhHantHKIndex ID = 768
+ zhHantMOIndex ID = 769
+ zhHantTWIndex ID = 770
+ zuIndex ID = 771
+ zuZAIndex ID = 772
+ caESvalenciaIndex ID = 773
+ enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+ // Entry 0 - 1F
+ 0x00000000, 0x01600000, 0x016000d3, 0x01600162,
+ 0x01c00000, 0x01c00052, 0x02100000, 0x02100081,
+ 0x02700000, 0x02700070, 0x03a00000, 0x03a00001,
+ 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068,
+ 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098,
+ 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad,
+ 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca,
+ 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109,
+ // Entry 20 - 3F
+ 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d,
+ 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000,
+ 0x04300000, 0x0430009a, 0x04400000, 0x04400130,
+ 0x04800000, 0x0480006f, 0x05800000, 0x05820000,
+ 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000,
+ 0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+ 0x07500163, 0x07900000, 0x07900130, 0x07e00000,
+ 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4,
+ // Entry 40 - 5F
+ 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000,
+ 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079,
+ 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000,
+ 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000,
+ 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f,
+ 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000,
+ 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000,
+ 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d,
+ // Entry 60 - 7F
+ 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107,
+ 0x10000000, 0x1000007c, 0x10100000, 0x10100064,
+ 0x10100083, 0x10800000, 0x108000a5, 0x10d00000,
+ 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061,
+ 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000,
+ 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000,
+ 0x12400052, 0x12800000, 0x12b00000, 0x12b00115,
+ 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5,
+ // Entry 80 - 9F
+ 0x13000000, 0x13000081, 0x13000123, 0x13600000,
+ 0x1360005e, 0x13600088, 0x13900000, 0x13900001,
+ 0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+ 0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+ 0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+ 0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+ 0x13900050, 0x13900052, 0x1390005d, 0x1390005e,
+ 0x13900061, 0x13900062, 0x13900064, 0x13900065,
+ // Entry A0 - BF
+ 0x1390006e, 0x13900073, 0x13900074, 0x13900075,
+ 0x13900076, 0x1390007c, 0x1390007d, 0x13900080,
+ 0x13900081, 0x13900082, 0x13900084, 0x1390008b,
+ 0x1390008d, 0x1390008e, 0x13900097, 0x13900098,
+ 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0,
+ 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa,
+ 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6,
+ 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8,
+ // Entry C0 - DF
+ 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf,
+ 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7,
+ 0x139000da, 0x139000de, 0x139000e0, 0x139000e1,
+ 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec,
+ 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a,
+ 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e,
+ 0x1390010f, 0x13900110, 0x13900113, 0x13900118,
+ 0x1390011c, 0x1390011e, 0x13900120, 0x13900126,
+ // Entry E0 - FF
+ 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130,
+ 0x13900132, 0x13900134, 0x13900136, 0x1390013a,
+ 0x1390013d, 0x1390013e, 0x13900140, 0x13900143,
+ 0x13900162, 0x13900163, 0x13900165, 0x13c00000,
+ 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+ 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+ 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066,
+ 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087,
+ // Entry 100 - 11F
+ 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0,
+ 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8,
+ 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136,
+ 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b,
+ 0x14500000, 0x1450006f, 0x14600000, 0x14600052,
+ 0x14800000, 0x14800024, 0x1480009d, 0x14e00000,
+ 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115,
+ 0x15100000, 0x15100073, 0x15300000, 0x153000e8,
+ // Entry 120 - 13F
+ 0x15800000, 0x15800064, 0x15800077, 0x15e00000,
+ 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+ 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+ 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+ 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b,
+ 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087,
+ 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb,
+ 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4,
+ // Entry 140 - 15F
+ 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4,
+ 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103,
+ 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d,
+ 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140,
+ 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f,
+ 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097,
+ 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f,
+ 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3,
+ // Entry 160 - 17F
+ 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000,
+ 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000,
+ 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000,
+ 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000,
+ 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091,
+ 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093,
+ 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096,
+ 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053,
+ // Entry 180 - 19F
+ 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e,
+ 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114,
+ 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000,
+ 0x200000a3, 0x20300000, 0x20700000, 0x20700052,
+ 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000,
+ 0x20f00000, 0x21000000, 0x2100007e, 0x21200000,
+ 0x21200068, 0x21600000, 0x21700000, 0x217000a5,
+ 0x21f00000, 0x22300000, 0x22300130, 0x22700000,
+ // Entry 1A0 - 1BF
+ 0x2270005b, 0x23400000, 0x234000c4, 0x23900000,
+ 0x239000a5, 0x24200000, 0x242000af, 0x24400000,
+ 0x24400052, 0x24500000, 0x24500083, 0x24600000,
+ 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000,
+ 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac,
+ 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a,
+ 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052,
+ 0x26e00000, 0x26e00061, 0x27400000, 0x28100000,
+ // Entry 1C0 - 1DF
+ 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000,
+ 0x29100130, 0x29500000, 0x295000b8, 0x2a300000,
+ 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000,
+ 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+ 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c,
+ 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000,
+ 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000,
+ 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000,
+ // Entry 1E0 - 1FF
+ 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5,
+ 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0,
+ 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052,
+ 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a,
+ 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000,
+ 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1,
+ 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000,
+ 0x32500052, 0x33100000, 0x331000c5, 0x33a00000,
+ // Entry 200 - 21F
+ 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3,
+ 0x34700000, 0x347000db, 0x34700111, 0x34e00000,
+ 0x34e00165, 0x35000000, 0x35000061, 0x350000da,
+ 0x35100000, 0x3510009a, 0x351000dc, 0x36700000,
+ 0x36700030, 0x36700036, 0x36700040, 0x3670005c,
+ 0x367000da, 0x36700117, 0x3670011c, 0x36800000,
+ 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000,
+ 0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+ // Entry 220 - 23F
+ 0x37a00000, 0x38000000, 0x38000118, 0x38700000,
+ 0x38900000, 0x38900132, 0x39000000, 0x39000070,
+ 0x390000a5, 0x39500000, 0x3950009a, 0x39800000,
+ 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000,
+ 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000,
+ 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001,
+ 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+ 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087,
+ // Entry 240 - 25F
+ 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2,
+ 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000,
+ 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000,
+ 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+ 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130,
+ 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af,
+ 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000,
+ 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000,
+ // Entry 260 - 27F
+ 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000,
+ 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000,
+ 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d,
+ 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4,
+ 0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+ 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb,
+ 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112,
+ 0x41600000, 0x41600110, 0x41c00000, 0x41d00000,
+ // Entry 280 - 29F
+ 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000,
+ 0x42300000, 0x42300165, 0x42900000, 0x42900063,
+ 0x42900070, 0x429000a5, 0x42900116, 0x43100000,
+ 0x43100027, 0x431000c3, 0x4310014e, 0x43200000,
+ 0x43220000, 0x43220033, 0x432200be, 0x43220106,
+ 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be,
+ 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000,
+ 0x43b00000, 0x44400000, 0x44400031, 0x44400073,
+ // Entry 2A0 - 2BF
+ 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5,
+ 0x44500130, 0x44500132, 0x44e00000, 0x45000000,
+ 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e,
+ 0x46100000, 0x4610009a, 0x46400000, 0x464000a5,
+ 0x46400132, 0x46700000, 0x46700125, 0x46b00000,
+ 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070,
+ 0x47100000, 0x47600000, 0x47600128, 0x47a00000,
+ 0x48000000, 0x48200000, 0x4820012a, 0x48a00000,
+ // Entry 2C0 - 2DF
+ 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000,
+ 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000,
+ 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+ 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9,
+ 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000,
+ 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000,
+ 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5,
+ 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000,
+ // Entry 2E0 - 2FF
+ 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000,
+ 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115,
+ 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000,
+ 0x50900052, 0x51200000, 0x51200001, 0x51800000,
+ 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000,
+ 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000,
+ 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053,
+ 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000,
+ // Entry 300 - 31F
+ 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000,
+ 0x52f00162,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 000000000..ca135d295
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag{language: afIndex, locale: afIndex}
+ Amharic Tag = Tag{language: amIndex, locale: amIndex}
+ Arabic Tag = Tag{language: arIndex, locale: arIndex}
+ ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+ Azerbaijani Tag = Tag{language: azIndex, locale: azIndex}
+ Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex}
+ Bengali Tag = Tag{language: bnIndex, locale: bnIndex}
+ Catalan Tag = Tag{language: caIndex, locale: caIndex}
+ Czech Tag = Tag{language: csIndex, locale: csIndex}
+ Danish Tag = Tag{language: daIndex, locale: daIndex}
+ German Tag = Tag{language: deIndex, locale: deIndex}
+ Greek Tag = Tag{language: elIndex, locale: elIndex}
+ English Tag = Tag{language: enIndex, locale: enIndex}
+ AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex}
+ BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex}
+ Spanish Tag = Tag{language: esIndex, locale: esIndex}
+ EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex}
+ LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+ Estonian Tag = Tag{language: etIndex, locale: etIndex}
+ Persian Tag = Tag{language: faIndex, locale: faIndex}
+ Finnish Tag = Tag{language: fiIndex, locale: fiIndex}
+ Filipino Tag = Tag{language: filIndex, locale: filIndex}
+ French Tag = Tag{language: frIndex, locale: frIndex}
+ CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex}
+ Gujarati Tag = Tag{language: guIndex, locale: guIndex}
+ Hebrew Tag = Tag{language: heIndex, locale: heIndex}
+ Hindi Tag = Tag{language: hiIndex, locale: hiIndex}
+ Croatian Tag = Tag{language: hrIndex, locale: hrIndex}
+ Hungarian Tag = Tag{language: huIndex, locale: huIndex}
+ Armenian Tag = Tag{language: hyIndex, locale: hyIndex}
+ Indonesian Tag = Tag{language: idIndex, locale: idIndex}
+ Icelandic Tag = Tag{language: isIndex, locale: isIndex}
+ Italian Tag = Tag{language: itIndex, locale: itIndex}
+ Japanese Tag = Tag{language: jaIndex, locale: jaIndex}
+ Georgian Tag = Tag{language: kaIndex, locale: kaIndex}
+ Kazakh Tag = Tag{language: kkIndex, locale: kkIndex}
+ Khmer Tag = Tag{language: kmIndex, locale: kmIndex}
+ Kannada Tag = Tag{language: knIndex, locale: knIndex}
+ Korean Tag = Tag{language: koIndex, locale: koIndex}
+ Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex}
+ Lao Tag = Tag{language: loIndex, locale: loIndex}
+ Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex}
+ Latvian Tag = Tag{language: lvIndex, locale: lvIndex}
+ Macedonian Tag = Tag{language: mkIndex, locale: mkIndex}
+ Malayalam Tag = Tag{language: mlIndex, locale: mlIndex}
+ Mongolian Tag = Tag{language: mnIndex, locale: mnIndex}
+ Marathi Tag = Tag{language: mrIndex, locale: mrIndex}
+ Malay Tag = Tag{language: msIndex, locale: msIndex}
+ Burmese Tag = Tag{language: myIndex, locale: myIndex}
+ Nepali Tag = Tag{language: neIndex, locale: neIndex}
+ Dutch Tag = Tag{language: nlIndex, locale: nlIndex}
+ Norwegian Tag = Tag{language: noIndex, locale: noIndex}
+ Punjabi Tag = Tag{language: paIndex, locale: paIndex}
+ Polish Tag = Tag{language: plIndex, locale: plIndex}
+ Portuguese Tag = Tag{language: ptIndex, locale: ptIndex}
+ BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+ EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+ Romanian Tag = Tag{language: roIndex, locale: roIndex}
+ Russian Tag = Tag{language: ruIndex, locale: ruIndex}
+ Sinhala Tag = Tag{language: siIndex, locale: siIndex}
+ Slovak Tag = Tag{language: skIndex, locale: skIndex}
+ Slovenian Tag = Tag{language: slIndex, locale: slIndex}
+ Albanian Tag = Tag{language: sqIndex, locale: sqIndex}
+ Serbian Tag = Tag{language: srIndex, locale: srIndex}
+ SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+ Swedish Tag = Tag{language: svIndex, locale: svIndex}
+ Swahili Tag = Tag{language: swIndex, locale: swIndex}
+ Tamil Tag = Tag{language: taIndex, locale: taIndex}
+ Telugu Tag = Tag{language: teIndex, locale: teIndex}
+ Thai Tag = Tag{language: thIndex, locale: thIndex}
+ Turkish Tag = Tag{language: trIndex, locale: trIndex}
+ Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex}
+ Urdu Tag = Tag{language: urIndex, locale: urIndex}
+ Uzbek Tag = Tag{language: uzIndex, locale: uzIndex}
+ Vietnamese Tag = Tag{language: viIndex, locale: viIndex}
+ Chinese Tag = Tag{language: zhIndex, locale: zhIndex}
+ SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+ TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+ Zulu Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 000000000..4ae78e0fa
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "sort"
+ "strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+ Tag Tag
+
+ private string // the x extension
+ variants []string
+ extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+ t := b.Tag
+
+ if len(b.extensions) > 0 || len(b.variants) > 0 {
+ sort.Sort(sortVariants(b.variants))
+ sort.Strings(b.extensions)
+
+ if b.private != "" {
+ b.extensions = append(b.extensions, b.private)
+ }
+ n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+ buf := make([]byte, n)
+ p := t.genCoreBytes(buf)
+ t.pVariant = byte(p)
+ p += appendTokens(buf[p:], b.variants...)
+ t.pExt = uint16(p)
+ p += appendTokens(buf[p:], b.extensions...)
+ t.str = string(buf[:p])
+ // We may not always need to remake the string, but when or when not
+ // to do so is rather tricky.
+ scan := makeScanner(buf[:p])
+ t, _ = parse(&scan, "")
+ return t
+
+ } else if b.private != "" {
+ t.str = b.private
+ t.RemakeString()
+ }
+ return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+ b.Tag.LangID = t.LangID
+ b.Tag.RegionID = t.RegionID
+ b.Tag.ScriptID = t.ScriptID
+ // TODO: optimize
+ b.variants = b.variants[:0]
+ if variants := t.Variants(); variants != "" {
+ for _, vr := range strings.Split(variants[1:], "-") {
+ b.variants = append(b.variants, vr)
+ }
+ }
+ b.extensions, b.private = b.extensions[:0], ""
+ for _, e := range t.Extensions() {
+ b.AddExt(e)
+ }
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+ if e[0] == 'x' {
+ if b.private == "" {
+ b.private = e
+ }
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] += e[1:]
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+ if e[0] == 'x' {
+ b.private = e
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] = e + s[1:]
+ } else {
+ b.extensions[i] = e
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+ for _, v := range v {
+ if v != "" {
+ b.variants = append(b.variants, v)
+ }
+ }
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+ b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+ b.private = ""
+ b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+ for _, t := range token {
+ n += len(t) + 1
+ }
+ return
+}
+
+func appendTokens(b []byte, token ...string) int {
+ p := 0
+ for _, t := range token {
+ b[p] = '-'
+ copy(b[p+1:], t)
+ p += 1 + len(t)
+ }
+ return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+ return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+ s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+ return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 000000000..9b20b88fe
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+ base := make([]Language, 0, NumLanguages)
+ for i := 0; i < langNoIndexOffset; i++ {
+ // We included "und" already for the value 0.
+ if i != nonCanonicalUnd {
+ base = append(base, Language(i))
+ }
+ }
+ i := langNoIndexOffset
+ for _, v := range langNoIndex {
+ for k := 0; k < 8; k++ {
+ if v&1 == 1 {
+ base = append(base, Language(i))
+ }
+ v >>= 1
+ i++
+ }
+ }
+ return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 000000000..09d41c736
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,627 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+const (
+ // maxCoreSize is the maximum size of a BCP 47 tag without variants and
+ // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+ maxCoreSize = 12
+
+ // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+ // is large enough to hold at least 99% of the BCP 47 tags.
+ max99thPercentileSize = 32
+
+ // maxSimpleUExtensionSize is the maximum size of a -u extension with one
+ // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+ maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+ // TODO: the following fields have the form TagTypeID. This name is chosen
+ // to allow refactoring the public package without conflicting with its
+ // Base, Script, and Region methods. Once the transition is fully completed
+ // the ID can be stripped from the name.
+
+ LangID Language
+ RegionID Region
+ // TODO: we will soon run out of positions for ScriptID. Idea: instead of
+ // storing lang, region, and ScriptID codes, store only the compact index and
+ // have a lookup table from this code to its expansion. This greatly speeds
+ // up table lookup, speed up common variant cases.
+ // This will also immediately free up 3 extra bytes. Also, the pVariant
+ // field can now be moved to the lookup table, as the compact index uniquely
+ // determines the offset of a possible variant.
+ ScriptID Script
+ pVariant byte // offset in str, includes preceding '-'
+ pExt uint16 // offset of first extension, includes preceding '-'
+
+ // str is the string representation of the Tag. It will only be used if the
+ // tag has variants or extensions.
+ str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ t, _ := Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+ return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+ return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if int(t.pVariant) < len(t.str) {
+ return false
+ }
+ return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+ return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+ if t.str == "" {
+ return
+ }
+ extra := t.str[t.pVariant:]
+ if t.pVariant > 0 {
+ extra = extra[1:]
+ }
+ if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+ t.str = extra
+ t.pVariant = 0
+ t.pExt = 0
+ return
+ }
+ var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+ b := buf[:t.genCoreBytes(buf[:])]
+ if extra != "" {
+ diff := len(b) - int(t.pVariant)
+ b = append(b, '-')
+ b = append(b, extra...)
+ t.pVariant = uint8(int(t.pVariant) + diff)
+ t.pExt = uint16(int(t.pExt) + diff)
+ } else {
+ t.pVariant = uint8(len(b))
+ t.pExt = uint16(len(b))
+ }
+ t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+ n := t.LangID.StringToBuf(buf[:])
+ if t.ScriptID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.ScriptID.String())
+ }
+ if t.RegionID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.RegionID.String())
+ }
+ return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ if t.str != "" {
+ return t.str
+ }
+ if t.ScriptID == 0 && t.RegionID == 0 {
+ return t.LangID.String()
+ }
+ buf := [maxCoreSize]byte{}
+ return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ if t.str != "" {
+ text = append(text, t.str...)
+ } else if t.ScriptID == 0 && t.RegionID == 0 {
+ text = append(text, t.LangID.String()...)
+ } else {
+ buf := [maxCoreSize]byte{}
+ text = buf[:t.genCoreBytes(buf[:])]
+ }
+ return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ tag, err := Parse(string(text))
+ *t = tag
+ return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+ if t.pVariant == 0 {
+ return ""
+ }
+ return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+ if t.pExt > 0 {
+ return t.str[t.pVariant:t.pExt]
+ }
+ return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+ return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.str != "" {
+ // Strip the variants and extensions.
+ b, s, r := t.Raw()
+ t = Tag{LangID: b, ScriptID: s, RegionID: r}
+ if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID == t.ScriptID {
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return t
+ }
+ if t.LangID != 0 {
+ if t.RegionID != 0 {
+ maxScript := t.ScriptID
+ if maxScript == 0 {
+ max, _ := addTags(t)
+ maxScript = max.ScriptID
+ }
+
+ for i := range parents {
+ if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+ for _, r := range parents[i].fromRegion {
+ if Region(r) == t.RegionID {
+ return Tag{
+ LangID: t.LangID,
+ ScriptID: Script(parents[i].script),
+ RegionID: Region(parents[i].toRegion),
+ }
+ }
+ }
+ }
+ }
+
+ // Strip the script if it is the default one.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != maxScript {
+ return Tag{LangID: t.LangID, ScriptID: maxScript}
+ }
+ return Tag{LangID: t.LangID}
+ } else if t.ScriptID != 0 {
+ // The parent for an base-script pair with a non-default script is
+ // "und" instead of the base language.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != t.ScriptID {
+ return Und
+ }
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+ defer func() {
+ if recover() != nil {
+ ext = ""
+ err = ErrSyntax
+ }
+ }()
+
+ scan := makeScannerString(s)
+ var end int
+ if n := len(scan.token); n != 1 {
+ return "", ErrSyntax
+ }
+ scan.toLower(0, len(scan.b))
+ end = parseExtension(&scan)
+ if end != len(s) {
+ return "", ErrSyntax
+ }
+ return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+ return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+ return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ if ext[0] == x {
+ return ext, true
+ }
+ }
+ return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+ e := []string{}
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ e = append(e, ext)
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+//
+// If there are multiple types associated with a key, only the first will be
+// returned. If there is no type associated with a key, it returns the empty
+// string.
+func (t Tag) TypeForKey(key string) string {
+ if _, start, end, _ := t.findTypeForKey(key); end != start {
+ s := t.str[start:end]
+ if p := strings.IndexByte(s, '-'); p >= 0 {
+ s = s[:p]
+ }
+ return s
+ }
+ return ""
+}
+
+var (
+ errPrivateUse = errors.New("cannot set a key on a private use tag")
+ errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ if t.IsPrivateUse() {
+ return t, errPrivateUse
+ }
+ if len(key) != 2 {
+ return t, errInvalidArguments
+ }
+
+ // Remove the setting if value is "".
+ if value == "" {
+ start, sep, end, _ := t.findTypeForKey(key)
+ if start != sep {
+ // Remove a possible empty extension.
+ switch {
+ case t.str[start-2] != '-': // has previous elements.
+ case end == len(t.str), // end of string
+ end+2 < len(t.str) && t.str[end+2] == '-': // end of extension
+ start -= 2
+ }
+ if start == int(t.pVariant) && end == len(t.str) {
+ t.str = ""
+ t.pVariant, t.pExt = 0, 0
+ } else {
+ t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+ }
+ }
+ return t, nil
+ }
+
+ if len(value) < 3 || len(value) > 8 {
+ return t, errInvalidArguments
+ }
+
+ var (
+ buf [maxCoreSize + maxSimpleUExtensionSize]byte
+ uStart int // start of the -u extension.
+ )
+
+ // Generate the tag string if needed.
+ if t.str == "" {
+ uStart = t.genCoreBytes(buf[:])
+ buf[uStart] = '-'
+ uStart++
+ }
+
+ // Create new key-type pair and parse it to verify.
+ b := buf[uStart:]
+ copy(b, "u-")
+ copy(b[2:], key)
+ b[4] = '-'
+ b = b[:5+copy(b[5:], value)]
+ scan := makeScanner(b)
+ if parseExtensions(&scan); scan.err != nil {
+ return t, scan.err
+ }
+
+ // Assemble the replacement string.
+ if t.str == "" {
+ t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+ t.str = string(buf[:uStart+len(b)])
+ } else {
+ s := t.str
+ start, sep, end, hasExt := t.findTypeForKey(key)
+ if start == sep {
+ if hasExt {
+ b = b[2:]
+ }
+ t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:])
+ } else {
+ t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:])
+ }
+ }
+ return t, nil
+}
+
+// findTypeForKey returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) {
+ p := int(t.pExt)
+ if len(key) != 2 || p == len(t.str) || p == 0 {
+ return p, p, p, false
+ }
+ s := t.str
+
+ // Find the correct extension.
+ for p++; s[p] != 'u'; p++ {
+ if s[p] > 'u' {
+ p--
+ return p, p, p, false
+ }
+ if p = nextExtension(s, p); p == len(s) {
+ return len(s), len(s), len(s), false
+ }
+ }
+ // Proceed to the hyphen following the extension name.
+ p++
+
+ // curKey is the key currently being processed.
+ curKey := ""
+
+ // Iterate over keys until we get the end of a section.
+ for {
+ end = p
+ for p++; p < len(s) && s[p] != '-'; p++ {
+ }
+ n := p - end - 1
+ if n <= 2 && curKey == key {
+ if sep < end {
+ sep++
+ }
+ return start, sep, end, true
+ }
+ switch n {
+ case 0, // invalid string
+ 1: // next extension
+ return end, end, end, true
+ case 2:
+ // next key
+ curKey = s[end+1 : p]
+ if curKey > key {
+ return end, end, end, true
+ }
+ start = end
+ sep = p
+ }
+ }
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (l Language, err error) {
+ defer func() {
+ if recover() != nil {
+ l = 0
+ err = ErrSyntax
+ }
+ }()
+
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (scr Script, err error) {
+ defer func() {
+ if recover() != nil {
+ scr = 0
+ err = ErrSyntax
+ }
+ }()
+
+ if len(s) != 4 {
+ return 0, ErrSyntax
+ }
+ var buf [4]byte
+ return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (r Region, err error) {
+ defer func() {
+ if recover() != nil {
+ r = 0
+ err = ErrSyntax
+ }
+ }()
+
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+ return false
+ }
+ return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ if r == 0 {
+ return false
+ }
+ return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ if r == c {
+ return true
+ }
+ g := regionInclusion[r]
+ if g >= nRegionGroups {
+ return false
+ }
+ m := regionContainment[g]
+
+ d := regionInclusion[c]
+ b := regionInclusionBits[d]
+
+ // A contained country may belong to multiple disjoint groups. Matching any
+ // of these indicates containment. If the contained region is a group, it
+ // must strictly be a subset.
+ if d >= nRegionGroups {
+ return b&m != 0
+ }
+ return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+ // difference between ISO 3166-1 and IANA ccTLD.
+ if r == _GB {
+ r = _UK
+ }
+ if (r.typ() & ccTLD) == 0 {
+ return 0, errNoTLD
+ }
+ return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ if cr := normRegion(r); cr != 0 {
+ return cr
+ }
+ return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ ID uint8
+ str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (v Variant, err error) {
+ defer func() {
+ if recover() != nil {
+ v = Variant{}
+ err = ErrSyntax
+ }
+ }()
+
+ s = strings.ToLower(s)
+ if id, ok := variantIndex[s]; ok {
+ return Variant{id, s}, nil
+ }
+ return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.str
+}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
new file mode 100644
index 000000000..231b4fbde
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -0,0 +1,412 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "fmt"
+ "sort"
+ "strconv"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+ if !tag.FixCase(form, key) {
+ return 0, ErrSyntax
+ }
+ i := idx.Index(key)
+ if i == -1 {
+ return 0, NewValueError(key)
+ }
+ return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+ return sort.Search(len(imap), func(i int) bool {
+ return imap[i] >= key
+ })
+}
+
+type Language uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (Language, error) {
+ if len(s) == 2 {
+ return getLangISO2(s)
+ }
+ return getLangISO3(s)
+}
+
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+ return normLang(id)
+}
+
+// normLang returns the mapped langID of id according to mapping m.
+func normLang(id Language) (Language, AliasType) {
+ k := sort.Search(len(AliasMap), func(i int) bool {
+ return AliasMap[i].From >= uint16(id)
+ })
+ if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+ return Language(AliasMap[k].To), AliasTypes[k]
+ }
+ return id, AliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (Language, error) {
+ if !tag.FixCase("zz", s) {
+ return 0, ErrSyntax
+ }
+ if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+ return Language(i), nil
+ }
+ return 0, NewValueError(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+ v := uint(0)
+ for i := 0; i < len(s); i++ {
+ v *= base
+ v += uint(s[i] - 'a')
+ }
+ return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+ for i := len(s) - 1; i >= 0; i-- {
+ s[i] = byte(v%base) + 'a'
+ v /= base
+ }
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (Language, error) {
+ if tag.FixCase("und", s) {
+ // first try to match canonical 3-letter entries
+ for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+ if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+ // We treat "und" as special and always translate it to "unspecified".
+ // Note that ZZ and Zzzz are private use and are not treated as
+ // unspecified by default.
+ id := Language(i)
+ if id == nonCanonicalUnd {
+ return 0, nil
+ }
+ return id, nil
+ }
+ }
+ if i := altLangISO3.Index(s); i != -1 {
+ return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+ }
+ n := strToInt(s)
+ if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+ return Language(n) + langNoIndexOffset, nil
+ }
+ // Check for non-canonical uses of ISO3.
+ for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+ if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Language(i), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+// StringToBuf writes the string to b and returns the number of bytes
+// written. cap(b) must be >= 3.
+func (id Language) StringToBuf(b []byte) int {
+ if id >= langNoIndexOffset {
+ intToStr(uint(id)-langNoIndexOffset, b[:3])
+ return 3
+ } else if id == 0 {
+ return copy(b, "und")
+ }
+ l := lang[id<<2:]
+ if l[3] == 0 {
+ return copy(b, l[:3])
+ }
+ return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b Language) String() string {
+ if b == 0 {
+ return "und"
+ } else if b >= langNoIndexOffset {
+ b -= langNoIndexOffset
+ buf := [3]byte{}
+ intToStr(uint(b), buf[:])
+ return string(buf[:])
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ }
+ return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Language) ISO3() string {
+ if b == 0 || b >= langNoIndexOffset {
+ return b.String()
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ } else if l[2] == 0 {
+ return altLangISO3.Elem(int(l[3]))[:3]
+ }
+ // This allocation will only happen for 3-letter ISO codes
+ // that are non-canonical BCP 47 language identifiers.
+ return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Language) IsPrivateUse() bool {
+ return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+ if b < langNoIndexOffset {
+ return Script(suppressScript[b])
+ }
+ return 0
+}
+
+type Region uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (Region, error) {
+ if len(s) == 3 {
+ if isAlpha(s[0]) {
+ return getRegionISO3(s)
+ }
+ if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+ return getRegionM49(int(i))
+ }
+ }
+ return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (Region, error) {
+ i, err := findIndex(regionISO, s, "ZZ")
+ if err != nil {
+ return 0, err
+ }
+ return Region(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (Region, error) {
+ if tag.FixCase("ZZZ", s) {
+ for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+ if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Region(i) + isoRegionOffset, nil
+ }
+ }
+ for i := 0; i < len(altRegionISO3); i += 3 {
+ if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+ return Region(altRegionIDs[i/3]), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+func getRegionM49(n int) (Region, error) {
+ if 0 < n && n <= 999 {
+ const (
+ searchBits = 7
+ regionBits = 9
+ regionMask = 1<> searchBits
+ buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+ val := uint16(n) << regionBits // we rely on bits shifting out
+ i := sort.Search(len(buf), func(i int) bool {
+ return buf[i] >= val
+ })
+ if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+ return Region(r & regionMask), nil
+ }
+ }
+ var e ValueError
+ fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+ return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r Region) Region {
+ m := regionOldMap
+ k := sort.Search(len(m), func(i int) bool {
+ return m[i].From >= uint16(r)
+ })
+ if k < len(m) && m[k].From == uint16(r) {
+ return Region(m[k].To)
+ }
+ return 0
+}
+
+const (
+ iso3166UserAssigned = 1 << iota
+ ccTLD
+ bcp47Region
+)
+
+func (r Region) typ() byte {
+ return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ if r < isoRegionOffset {
+ if r == 0 {
+ return "ZZ"
+ }
+ return fmt.Sprintf("%03d", r.M49())
+ }
+ r -= isoRegionOffset
+ return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ if r < isoRegionOffset {
+ return "ZZZ"
+ }
+ r -= isoRegionOffset
+ reg := regionISO.Elem(int(r))
+ switch reg[2] {
+ case 0:
+ return altRegionISO3[reg[3]:][:3]
+ case ' ':
+ return "ZZZ"
+ }
+ return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.typ()&iso3166UserAssigned != 0
+}
+
+type Script uint16
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
+ i, err := findIndex(idx, s, "Zzzz")
+ return Script(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ if s == 0 {
+ return "Zzzz"
+ }
+ return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+ maxAltTaglen = len("en-US-POSIX")
+ maxLen = maxAltTaglen
+)
+
+var (
+ // grandfatheredMap holds a mapping from legacy and grandfathered tags to
+ // their base language or index to more elaborate tag.
+ grandfatheredMap = map[[maxLen]byte]int16{
+ [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+ [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami
+ [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn
+ [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak
+ [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon
+ [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux
+ [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo
+ [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn
+ [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao
+ [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay
+ [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu
+ [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok
+ [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL
+ [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE
+ [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu
+ [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+ [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang
+
+ // Grandfathered tags with no modern replacement will be converted as
+ // follows:
+ [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+ [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed
+ [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default
+ [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian
+ [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min
+
+ // CLDR-specific tag.
+ [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root
+ [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+ }
+
+ altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+ altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+ if v, ok := grandfatheredMap[s]; ok {
+ if v < 0 {
+ return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+ }
+ t.LangID = Language(v)
+ return t, true
+ }
+ return t, false
+}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 000000000..75a2dbca7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+ if t.LangID == 0 {
+ t.LangID = id
+ }
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+ if t.ScriptID == 0 {
+ t.ScriptID = id
+ }
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+ if t.RegionID == 0 || t.RegionID.Contains(id) {
+ t.RegionID = id
+ }
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+ id, err := addTags(t)
+ if err != nil {
+ return t, err
+ } else if id.equalTags(t) {
+ return t, nil
+ }
+ id.RemakeString()
+ return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+ t.RegionID = Region(x.region)
+ }
+ return true
+ }
+ return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+ return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+ // We leave private use identifiers alone.
+ if t.IsPrivateUse() {
+ return t, nil
+ }
+ if t.ScriptID != 0 && t.RegionID != 0 {
+ if t.LangID != 0 {
+ // already fully specified
+ specializeRegion(&t)
+ return t, nil
+ }
+ // Search matches for und-script-region. Note that for these cases
+ // region will never be a group so there is no need to check for this.
+ list := likelyRegion[t.RegionID : t.RegionID+1]
+ if x := list[0]; x.flags&isList != 0 {
+ list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+ }
+ for _, x := range list {
+ // Deviating from the spec. See match_test.go for details.
+ if Script(x.script) == t.ScriptID {
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ }
+ if t.LangID != 0 {
+ // Search matches for lang-script and lang-region, where lang != und.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ list := likelyLangList[x.region : x.region+uint16(x.script)]
+ if t.ScriptID != 0 {
+ for _, x := range list {
+ if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ return t, nil
+ }
+ }
+ } else if t.RegionID != 0 {
+ count := 0
+ goodScript := true
+ tt := t
+ for _, x := range list {
+ // We visit all entries for which the script was not
+ // defined, including the ones where the region was not
+ // defined. This allows for proper disambiguation within
+ // regions.
+ if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+ tt.RegionID = Region(x.region)
+ tt.setUndefinedScript(Script(x.script))
+ goodScript = goodScript && tt.ScriptID == Script(x.script)
+ count++
+ }
+ }
+ if count == 1 {
+ return tt, nil
+ }
+ // Even if we fail to find a unique Region, we might have
+ // an unambiguous script.
+ if goodScript {
+ t.ScriptID = tt.ScriptID
+ }
+ }
+ }
+ }
+ } else {
+ // Search matches for und-script.
+ if t.ScriptID != 0 {
+ x := likelyScript[t.ScriptID]
+ if x.region != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ // Search matches for und-region. If und-script-region exists, it would
+ // have been found earlier.
+ if t.RegionID != 0 {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if x.region != 0 {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ t.RegionID = Region(x.region)
+ }
+ } else {
+ x := likelyRegion[t.RegionID]
+ if x.flags&isList != 0 {
+ x = likelyRegionList[x.lang]
+ }
+ if x.script != 0 && x.flags != scriptInFrom {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ return t, nil
+ }
+ }
+ }
+ }
+
+ // Search matches for lang.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ x = likelyLangList[x.region]
+ }
+ if x.region != 0 {
+ t.setUndefinedScript(Script(x.script))
+ t.setUndefinedRegion(Region(x.region))
+ }
+ specializeRegion(&t)
+ if t.LangID == 0 {
+ t.LangID = _en // default language
+ }
+ return t, nil
+ }
+ return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+ t.LangID = id.LangID
+ t.ScriptID = id.ScriptID
+ t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+ t, err := minimizeTags(t)
+ if err != nil {
+ return t, err
+ }
+ t.RemakeString()
+ return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+ if t.equalTags(Und) {
+ return t, nil
+ }
+ max, err := addTags(t)
+ if err != nil {
+ return t, err
+ }
+ for _, id := range [...]Tag{
+ {LangID: t.LangID},
+ {LangID: t.LangID, RegionID: t.RegionID},
+ {LangID: t.LangID, ScriptID: t.ScriptID},
+ } {
+ if x, err := addTags(id); err == nil && max.equalTags(x) {
+ t.setTagsFrom(id)
+ break
+ }
+ }
+ return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 000000000..aad1e0acf
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,608 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+ return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+ for _, c := range s {
+ if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+ return false
+ }
+ }
+ return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+ v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+ var e ValueError
+ copy(e.v[:], tag)
+ return e
+}
+
+func (e ValueError) tag() []byte {
+ n := bytes.IndexByte(e.v[:], 0)
+ if n == -1 {
+ n = 8
+ }
+ return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+ return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+ return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+ b []byte
+ bytes [max99thPercentileSize]byte
+ token []byte
+ start int // start position of the current token
+ end int // end position of the current token
+ next int // next point for scan
+ err error
+ done bool
+}
+
+func makeScannerString(s string) scanner {
+ scan := scanner{}
+ if len(s) <= len(scan.bytes) {
+ scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+ } else {
+ scan.b = []byte(s)
+ }
+ scan.init()
+ return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+ scan := scanner{b: b}
+ scan.init()
+ return scan
+}
+
+func (s *scanner) init() {
+ for i, c := range s.b {
+ if c == '_' {
+ s.b[i] = '-'
+ }
+ }
+ s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+ for i := start; i < end; i++ {
+ c := s.b[i]
+ if 'A' <= c && c <= 'Z' {
+ s.b[i] += 'a' - 'A'
+ }
+ }
+}
+
+func (s *scanner) setError(e error) {
+ if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+ s.err = e
+ }
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+ s.start = oldStart
+ if end := oldStart + newSize; end != oldEnd {
+ diff := end - oldEnd
+ var b []byte
+ if n := len(s.b) + diff; n > cap(s.b) {
+ b = make([]byte, n)
+ copy(b, s.b[:oldStart])
+ } else {
+ b = s.b[:n]
+ }
+ copy(b[end:], s.b[oldEnd:])
+ s.b = b
+ s.next = end + (s.next - s.end)
+ s.end = end
+ }
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+ s.resizeRange(s.start, s.end, len(repl))
+ copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+ s.setError(e)
+ if s.start == 0 {
+ s.b = s.b[:+copy(s.b, s.b[s.next:])]
+ s.end = 0
+ } else {
+ s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+ s.end = s.start - 1
+ }
+ s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+ s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+ diff := end - start
+ s.next -= diff
+ s.start -= diff
+ s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string. Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+ end = s.end
+ s.token = nil
+ for s.start = s.next; s.next < len(s.b); {
+ i := bytes.IndexByte(s.b[s.next:], '-')
+ if i == -1 {
+ s.end = len(s.b)
+ s.next = len(s.b)
+ i = s.end - s.start
+ } else {
+ s.end = s.next + i
+ s.next = s.end + 1
+ }
+ token := s.b[s.start:s.end]
+ if i < 1 || i > 8 || !isAlphaNum(token) {
+ s.gobble(ErrSyntax)
+ continue
+ }
+ s.token = token
+ return end
+ }
+ if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+ s.setError(ErrSyntax)
+ s.b = s.b[:len(s.b)-1]
+ }
+ s.done = true
+ return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+ end = s.end
+ s.scan()
+ for ; len(s.token) >= min; s.scan() {
+ end = s.end
+ }
+ return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+ // TODO: consider supporting old-style locale key-value pairs.
+ if s == "" {
+ return Und, ErrSyntax
+ }
+ defer func() {
+ if recover() != nil {
+ t = Und
+ err = ErrSyntax
+ return
+ }
+ }()
+ if len(s) <= maxAltTaglen {
+ b := [maxAltTaglen]byte{}
+ for i, c := range s {
+ // Generating invalid UTF-8 is okay as it won't match.
+ if 'A' <= c && c <= 'Z' {
+ c += 'a' - 'A'
+ } else if c == '_' {
+ c = '-'
+ }
+ b[i] = byte(c)
+ }
+ if t, ok := grandfathered(b); ok {
+ return t, nil
+ }
+ }
+ scan := makeScannerString(s)
+ return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+ t = Und
+ var end int
+ if n := len(scan.token); n <= 1 {
+ scan.toLower(0, len(scan.b))
+ if n == 0 || scan.token[0] != 'x' {
+ return t, ErrSyntax
+ }
+ end = parseExtensions(scan)
+ } else if n >= 4 {
+ return Und, ErrSyntax
+ } else { // the usual case
+ t, end = parseTag(scan, true)
+ if n := len(scan.token); n == 1 {
+ t.pExt = uint16(end)
+ end = parseExtensions(scan)
+ } else if end < len(scan.b) {
+ scan.setError(ErrSyntax)
+ scan.b = scan.b[:end]
+ }
+ }
+ if int(t.pVariant) < len(scan.b) {
+ if end < len(s) {
+ s = s[:end]
+ }
+ if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+ t.str = s
+ } else {
+ t.str = string(scan.b)
+ }
+ } else {
+ t.pVariant, t.pExt = 0, 0
+ }
+ return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+// If doNorm is true, then - will be normalized to .
+func parseTag(scan *scanner, doNorm bool) (t Tag, end int) {
+ var e error
+ // TODO: set an error if an unknown lang, script or region is encountered.
+ t.LangID, e = getLangID(scan.token)
+ scan.setError(e)
+ scan.replace(t.LangID.String())
+ langStart := scan.start
+ end = scan.scan()
+ for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+ // From http://tools.ietf.org/html/bcp47, - tags are equivalent
+ // to a tag of the form .
+ if doNorm {
+ lang, e := getLangID(scan.token)
+ if lang != 0 {
+ t.LangID = lang
+ langStr := lang.String()
+ copy(scan.b[langStart:], langStr)
+ scan.b[langStart+len(langStr)] = '-'
+ scan.start = langStart + len(langStr) + 1
+ }
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+ t.ScriptID, e = getScriptID(script, scan.token)
+ if t.ScriptID == 0 {
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if n := len(scan.token); n >= 2 && n <= 3 {
+ t.RegionID, e = getRegionID(scan.token)
+ if t.RegionID == 0 {
+ scan.gobble(e)
+ } else {
+ scan.replace(t.RegionID.String())
+ }
+ end = scan.scan()
+ }
+ scan.toLower(scan.start, len(scan.b))
+ t.pVariant = byte(end)
+ end = parseVariants(scan, end, t)
+ t.pExt = uint16(end)
+ return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+ start := scan.start
+ varIDBuf := [4]uint8{}
+ variantBuf := [4][]byte{}
+ varID := varIDBuf[:0]
+ variant := variantBuf[:0]
+ last := -1
+ needSort := false
+ for ; len(scan.token) >= 4; scan.scan() {
+ // TODO: measure the impact of needing this conversion and redesign
+ // the data structure if there is an issue.
+ v, ok := variantIndex[string(scan.token)]
+ if !ok {
+ // unknown variant
+ // TODO: allow user-defined variants?
+ scan.gobble(NewValueError(scan.token))
+ continue
+ }
+ varID = append(varID, v)
+ variant = append(variant, scan.token)
+ if !needSort {
+ if last < int(v) {
+ last = int(v)
+ } else {
+ needSort = true
+ // There is no legal combinations of more than 7 variants
+ // (and this is by no means a useful sequence).
+ const maxVariants = 8
+ if len(varID) > maxVariants {
+ break
+ }
+ }
+ }
+ end = scan.end
+ }
+ if needSort {
+ sort.Sort(variantsSort{varID, variant})
+ k, l := 0, -1
+ for i, v := range varID {
+ w := int(v)
+ if l == w {
+ // Remove duplicates.
+ continue
+ }
+ varID[k] = varID[i]
+ variant[k] = variant[i]
+ k++
+ l = w
+ }
+ if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+ end = start - 1
+ } else {
+ scan.resizeRange(start, end, len(str))
+ copy(scan.b[scan.start:], str)
+ end = scan.end
+ }
+ }
+ return end
+}
+
+type variantsSort struct {
+ i []uint8
+ v [][]byte
+}
+
+func (s variantsSort) Len() int {
+ return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+ s.i[i], s.i[j] = s.i[j], s.i[i]
+ s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+ return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+ b [][]byte
+ n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+ return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+ b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+ for k := 0; k < b.n; k++ {
+ if b.b[i][k] == b.b[j][k] {
+ continue
+ }
+ return b.b[i][k] < b.b[j][k]
+ }
+ return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+ start := scan.start
+ exts := [][]byte{}
+ private := []byte{}
+ end := scan.end
+ for len(scan.token) == 1 {
+ extStart := scan.start
+ ext := scan.token[0]
+ end = parseExtension(scan)
+ extension := scan.b[extStart:end]
+ if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+ scan.setError(ErrSyntax)
+ end = extStart
+ continue
+ } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+ scan.b = scan.b[:end]
+ return end
+ } else if ext == 'x' {
+ private = extension
+ break
+ }
+ exts = append(exts, extension)
+ }
+ sort.Sort(bytesSort{exts, 1})
+ if len(private) > 0 {
+ exts = append(exts, private)
+ }
+ scan.b = scan.b[:start]
+ if len(exts) > 0 {
+ scan.b = append(scan.b, bytes.Join(exts, separator)...)
+ } else if start > 0 {
+ // Strip trailing '-'.
+ scan.b = scan.b[:start-1]
+ }
+ return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+ start, end := scan.start, scan.end
+ switch scan.token[0] {
+ case 'u': // https://www.ietf.org/rfc/rfc6067.txt
+ attrStart := end
+ scan.scan()
+ for last := []byte{}; len(scan.token) > 2; scan.scan() {
+ if bytes.Compare(scan.token, last) != -1 {
+ // Attributes are unsorted. Start over from scratch.
+ p := attrStart + 1
+ scan.next = p
+ attrs := [][]byte{}
+ for scan.scan(); len(scan.token) > 2; scan.scan() {
+ attrs = append(attrs, scan.token)
+ end = scan.end
+ }
+ sort.Sort(bytesSort{attrs, 3})
+ copy(scan.b[p:], bytes.Join(attrs, separator))
+ break
+ }
+ last = scan.token
+ end = scan.end
+ }
+ // Scan key-type sequences. A key is of length 2 and may be followed
+ // by 0 or more "type" subtags from 3 to the maximum of 8 letters.
+ var last, key []byte
+ for attrEnd := end; len(scan.token) == 2; last = key {
+ key = scan.token
+ end = scan.end
+ for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
+ end = scan.end
+ }
+ // TODO: check key value validity
+ if bytes.Compare(key, last) != 1 || scan.err != nil {
+ // We have an invalid key or the keys are not sorted.
+ // Start scanning keys from scratch and reorder.
+ p := attrEnd + 1
+ scan.next = p
+ keys := [][]byte{}
+ for scan.scan(); len(scan.token) == 2; {
+ keyStart := scan.start
+ end = scan.end
+ for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
+ end = scan.end
+ }
+ keys = append(keys, scan.b[keyStart:end])
+ }
+ sort.Stable(bytesSort{keys, 2})
+ if n := len(keys); n > 0 {
+ k := 0
+ for i := 1; i < n; i++ {
+ if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+ k++
+ keys[k] = keys[i]
+ } else if !bytes.Equal(keys[k], keys[i]) {
+ scan.setError(ErrDuplicateKey)
+ }
+ }
+ keys = keys[:k+1]
+ }
+ reordered := bytes.Join(keys, separator)
+ if e := p + len(reordered); e < end {
+ scan.deleteRange(e, end)
+ end = e
+ }
+ copy(scan.b[p:], reordered)
+ break
+ }
+ }
+ case 't': // https://www.ietf.org/rfc/rfc6497.txt
+ scan.scan()
+ if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+ _, end = parseTag(scan, false)
+ scan.toLower(start, end)
+ }
+ for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+ end = scan.acceptMinSize(3)
+ }
+ case 'x':
+ end = scan.acceptMinSize(1)
+ default:
+ end = scan.acceptMinSize(2)
+ }
+ return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+ if s[p] == '-' {
+ p++
+ }
+ if s[p] == 'x' {
+ return len(s), s[p:]
+ }
+ end = nextExtension(s, p)
+ return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+ for n := len(s) - 3; p < n; {
+ if s[p] == '-' {
+ if s[p+2] == '-' {
+ return p
+ }
+ p += 3
+ } else {
+ p++
+ }
+ }
+ return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 000000000..14167e74e
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3494 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8798
+
+const NumScripts = 261
+
+const NumRegions = 358
+
+type FromTo struct {
+ From uint16
+ To uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+ _af = 22
+ _am = 39
+ _ar = 58
+ _az = 88
+ _bg = 126
+ _bn = 165
+ _ca = 215
+ _cs = 250
+ _da = 257
+ _de = 269
+ _el = 310
+ _en = 313
+ _es = 318
+ _et = 320
+ _fa = 328
+ _fi = 337
+ _fil = 339
+ _fr = 350
+ _gu = 420
+ _he = 444
+ _hi = 446
+ _hr = 465
+ _hu = 469
+ _hy = 471
+ _id = 481
+ _is = 504
+ _it = 505
+ _ja = 512
+ _ka = 528
+ _kk = 578
+ _km = 586
+ _kn = 593
+ _ko = 596
+ _ky = 650
+ _lo = 696
+ _lt = 704
+ _lv = 711
+ _mk = 767
+ _ml = 772
+ _mn = 779
+ _mo = 784
+ _mr = 795
+ _ms = 799
+ _mul = 806
+ _my = 817
+ _nb = 839
+ _ne = 849
+ _nl = 871
+ _no = 879
+ _pa = 925
+ _pl = 947
+ _pt = 960
+ _ro = 988
+ _ru = 994
+ _sh = 1031
+ _si = 1036
+ _sk = 1042
+ _sl = 1046
+ _sq = 1073
+ _sr = 1074
+ _sv = 1092
+ _sw = 1093
+ _ta = 1104
+ _te = 1121
+ _th = 1131
+ _tl = 1146
+ _tn = 1152
+ _tr = 1162
+ _uk = 1198
+ _ur = 1204
+ _uz = 1212
+ _vi = 1219
+ _zh = 1321
+ _zu = 1327
+ _jbo = 515
+ _ami = 1650
+ _bnn = 2357
+ _hak = 438
+ _tlh = 14467
+ _lb = 661
+ _nv = 899
+ _pwn = 12055
+ _tao = 14188
+ _tay = 14198
+ _tsu = 14662
+ _nn = 874
+ _sfb = 13629
+ _vgt = 15701
+ _sgg = 13660
+ _cmn = 3007
+ _nan = 835
+ _hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+// - if the first letter of the 2- and 3-letter ISO codes are the same:
+// the second and third letter of the 3-letter ISO code.
+// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+//
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+ "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+ "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+ "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+ "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+ "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+ "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+ "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+ "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+ "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+ "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+ "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+ "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+ "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+ "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+ "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+ "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+ "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+ "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+ "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+ "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+ "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+ "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+ "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+ "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+ "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+ "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+ "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+ "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+ "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+ "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+ "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+ "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+ "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+ "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+ "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+ "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+ "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+ "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+ "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+ "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+ "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+ "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+ "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+ "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+ "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+ "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+ "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+ "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+ "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+ "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+ "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+ "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+ "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+ "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+ "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+ "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+ "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+ "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+ "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+ "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+ "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+ "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+ "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+ "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+ "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+ "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+ "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+ "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+ "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+ "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+ "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+ "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+ "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+ "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+ "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+ "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+ "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+ "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+ "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+ "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+ "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+ "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+ "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+ "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+ "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+ "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+ "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+ "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+ "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+ "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+ "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+ "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+ "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+ "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+ "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+ "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+ "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+ "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+ "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+ "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+ "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+ "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+ "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+ "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+ "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+ "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+ "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+ "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+ "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+ "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+ "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+ "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+ "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+ "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+ "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+ "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+ "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+ "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+ "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+ "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+ "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+ "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+ "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+ "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+ // Entry 0 - 3F
+ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+ 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+ 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+ 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72,
+ 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+ 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+ 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a,
+ 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+ // Entry 40 - 7F
+ 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+ 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+ 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+ 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+ 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+ 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+ 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+ // Entry 80 - BF
+ 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff,
+ 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+ 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+ 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+ 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+ 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+ 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+ 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+ // Entry C0 - FF
+ 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+ 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56,
+ 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef,
+ 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+ 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35,
+ 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00,
+ 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03,
+ 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+ // Entry 100 - 13F
+ 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+ 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+ 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+ 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c,
+ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f,
+ 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+ 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+ 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb,
+ // Entry 140 - 17F
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16,
+ 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06,
+ 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09,
+ 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+ 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05,
+ 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04,
+ 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+ 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03,
+ // Entry 180 - 1BF
+ 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+ 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+ 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+ 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+ 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+ 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+ // Entry 200 - 23F
+ 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+ 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf,
+ 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3,
+ 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d,
+ 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01,
+ 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+ 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+ // Entry 240 - 27F
+ 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+ 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0,
+ 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+ 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+ 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+ 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+ 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+ // Entry 280 - 2BF
+ 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+ 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+ 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+ 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+ 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+ 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+ // Entry 2C0 - 2FF
+ 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2,
+ 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9,
+ 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+ 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+ 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+ 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+ 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08,
+ 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+ 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+ 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+ 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0,
+ 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+ 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+ 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+ 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+ 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+ 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+ 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+ 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+ 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+ // Entry 380 - 3BF
+ 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+ 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+ 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+ 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+ 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+ 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f,
+ 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+ // Entry 3C0 - 3FF
+ 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+ 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+ 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20,
+ 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11,
+ 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03,
+ 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10,
+ 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+ 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+ // Entry 400 - 43F
+ 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+ 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+ 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+ 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+ 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+ 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+ 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+ 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+ // Entry 440 - 47F
+ 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+ 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+ 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+ 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+ 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+ 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd,
+ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+ 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+ // Entry 480 - 4BF
+ 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb,
+ 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+ 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41,
+ 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05,
+ 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05,
+ 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+ 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1,
+ // Entry 4C0 - 4FF
+ 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed,
+ 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+ 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+ 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7,
+ 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+ 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+ // Entry 500 - 53F
+ 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+ 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7,
+ 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+ 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7,
+ 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+ 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+ 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+ // Entry 540 - 57F
+ 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ // Entry 580 - 5BF
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+ 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+ 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+ 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+ 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81,
+ 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+ // Entry 5C0 - 5FF
+ 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02,
+ 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+ 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+ 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+ 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20,
+ 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+ 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+ 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe,
+ // Entry 600 - 63F
+ 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+ 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+ 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+ 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f,
+ 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+ 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18,
+ 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+ // Entry 640 - 67F
+ 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c,
+ 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+ 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98,
+ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+ 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4,
+ 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+ 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9,
+ 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+ // Entry 680 - 6BF
+ 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+ 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda,
+ 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0,
+ 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+ 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06,
+ 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+ 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f,
+ // Entry 6C0 - 6FF
+ 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08,
+ 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41,
+ 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+ 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+ // Entry 700 - 73F
+ 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+ 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01,
+ 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+ 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+ 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 740 - 77F
+ 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+ 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46,
+ 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+ 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+ 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75,
+ 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+ // Entry 780 - 7BF
+ 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+ 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+ 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0,
+ 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+ 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41,
+ 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40,
+ 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+ 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+ // Entry 7C0 - 7FF
+ 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42,
+ 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56,
+ 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+ 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+ 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+ 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01,
+ 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+ // Entry 800 - 83F
+ 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+ 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1,
+ 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+ 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+ 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+ 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+ 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+ // Entry 840 - 87F
+ 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+ 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+ 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1,
+ 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+ 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+ 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+ // Entry 880 - 8BF
+ 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+ 0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+ 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 772 bytes, 193 elements
+var AliasMap = [193]FromTo{
+ 0: {From: 0x82, To: 0x88},
+ 1: {From: 0x187, To: 0x1ae},
+ 2: {From: 0x1f3, To: 0x1e1},
+ 3: {From: 0x1fb, To: 0x1bc},
+ 4: {From: 0x208, To: 0x512},
+ 5: {From: 0x20f, To: 0x20e},
+ 6: {From: 0x310, To: 0x3dc},
+ 7: {From: 0x347, To: 0x36f},
+ 8: {From: 0x407, To: 0x432},
+ 9: {From: 0x47a, To: 0x153},
+ 10: {From: 0x490, To: 0x451},
+ 11: {From: 0x4a2, To: 0x21},
+ 12: {From: 0x53e, To: 0x544},
+ 13: {From: 0x58f, To: 0x12d},
+ 14: {From: 0x62b, To: 0x34},
+ 15: {From: 0x62f, To: 0x14},
+ 16: {From: 0x630, To: 0x1eb1},
+ 17: {From: 0x651, To: 0x431},
+ 18: {From: 0x662, To: 0x431},
+ 19: {From: 0x6ed, To: 0x3a},
+ 20: {From: 0x6f8, To: 0x1d7},
+ 21: {From: 0x709, To: 0x3625},
+ 22: {From: 0x73e, To: 0x21a1},
+ 23: {From: 0x7b3, To: 0x56},
+ 24: {From: 0x7b9, To: 0x299b},
+ 25: {From: 0x7c5, To: 0x58},
+ 26: {From: 0x7e6, To: 0x145},
+ 27: {From: 0x80c, To: 0x5a},
+ 28: {From: 0x815, To: 0x8d},
+ 29: {From: 0x87e, To: 0x810},
+ 30: {From: 0x8a8, To: 0x8b7},
+ 31: {From: 0x8c3, To: 0xee3},
+ 32: {From: 0x8fa, To: 0x1dc},
+ 33: {From: 0x9ef, To: 0x331},
+ 34: {From: 0xa36, To: 0x2c5},
+ 35: {From: 0xa3d, To: 0xbf},
+ 36: {From: 0xabe, To: 0x3322},
+ 37: {From: 0xb38, To: 0x529},
+ 38: {From: 0xb75, To: 0x265a},
+ 39: {From: 0xb7e, To: 0xbc3},
+ 40: {From: 0xb9b, To: 0x44e},
+ 41: {From: 0xbbc, To: 0x4229},
+ 42: {From: 0xbbf, To: 0x529},
+ 43: {From: 0xbfe, To: 0x2da7},
+ 44: {From: 0xc2e, To: 0x3181},
+ 45: {From: 0xcb9, To: 0xf3},
+ 46: {From: 0xd08, To: 0xfa},
+ 47: {From: 0xdc8, To: 0x11a},
+ 48: {From: 0xdd7, To: 0x32d},
+ 49: {From: 0xdf8, To: 0xdfb},
+ 50: {From: 0xdfe, To: 0x531},
+ 51: {From: 0xe01, To: 0xdf3},
+ 52: {From: 0xedf, To: 0x205a},
+ 53: {From: 0xee9, To: 0x222e},
+ 54: {From: 0xeee, To: 0x2e9a},
+ 55: {From: 0xf39, To: 0x367},
+ 56: {From: 0x10d0, To: 0x140},
+ 57: {From: 0x1104, To: 0x2d0},
+ 58: {From: 0x11a0, To: 0x1ec},
+ 59: {From: 0x1279, To: 0x21},
+ 60: {From: 0x1424, To: 0x15e},
+ 61: {From: 0x1470, To: 0x14e},
+ 62: {From: 0x151f, To: 0xd9b},
+ 63: {From: 0x1523, To: 0x390},
+ 64: {From: 0x1532, To: 0x19f},
+ 65: {From: 0x1580, To: 0x210},
+ 66: {From: 0x1583, To: 0x10d},
+ 67: {From: 0x15a3, To: 0x3caf},
+ 68: {From: 0x1630, To: 0x222e},
+ 69: {From: 0x166a, To: 0x19b},
+ 70: {From: 0x16c8, To: 0x136},
+ 71: {From: 0x1700, To: 0x29f8},
+ 72: {From: 0x1718, To: 0x194},
+ 73: {From: 0x1727, To: 0xf3f},
+ 74: {From: 0x177a, To: 0x178},
+ 75: {From: 0x1809, To: 0x17b6},
+ 76: {From: 0x1816, To: 0x18f3},
+ 77: {From: 0x188a, To: 0x436},
+ 78: {From: 0x1979, To: 0x1d01},
+ 79: {From: 0x1a74, To: 0x2bb0},
+ 80: {From: 0x1a8a, To: 0x1f8},
+ 81: {From: 0x1b5a, To: 0x1fa},
+ 82: {From: 0x1b86, To: 0x1515},
+ 83: {From: 0x1d64, To: 0x2c9b},
+ 84: {From: 0x2038, To: 0x37b1},
+ 85: {From: 0x203d, To: 0x20dd},
+ 86: {From: 0x2042, To: 0x2e00},
+ 87: {From: 0x205a, To: 0x30b},
+ 88: {From: 0x20e3, To: 0x274},
+ 89: {From: 0x20ee, To: 0x263},
+ 90: {From: 0x20f2, To: 0x22d},
+ 91: {From: 0x20f9, To: 0x256},
+ 92: {From: 0x210f, To: 0x21eb},
+ 93: {From: 0x2135, To: 0x27d},
+ 94: {From: 0x2160, To: 0x913},
+ 95: {From: 0x2199, To: 0x121},
+ 96: {From: 0x21ce, To: 0x1561},
+ 97: {From: 0x21e6, To: 0x504},
+ 98: {From: 0x21f4, To: 0x49f},
+ 99: {From: 0x21fb, To: 0x269},
+ 100: {From: 0x222d, To: 0x121},
+ 101: {From: 0x2237, To: 0x121},
+ 102: {From: 0x2248, To: 0x217d},
+ 103: {From: 0x2262, To: 0x92a},
+ 104: {From: 0x2316, To: 0x3226},
+ 105: {From: 0x236a, To: 0x2835},
+ 106: {From: 0x2382, To: 0x3365},
+ 107: {From: 0x2472, To: 0x2c7},
+ 108: {From: 0x24e4, To: 0x2ff},
+ 109: {From: 0x24f0, To: 0x2fa},
+ 110: {From: 0x24fa, To: 0x31f},
+ 111: {From: 0x2550, To: 0xb5b},
+ 112: {From: 0x25a9, To: 0xe2},
+ 113: {From: 0x263e, To: 0x2d0},
+ 114: {From: 0x26c9, To: 0x26b4},
+ 115: {From: 0x26f9, To: 0x3c8},
+ 116: {From: 0x2727, To: 0x3caf},
+ 117: {From: 0x2755, To: 0x6a4},
+ 118: {From: 0x2765, To: 0x26b4},
+ 119: {From: 0x2789, To: 0x4358},
+ 120: {From: 0x27c9, To: 0x2001},
+ 121: {From: 0x28ea, To: 0x27b1},
+ 122: {From: 0x28ef, To: 0x2837},
+ 123: {From: 0x28fe, To: 0xaa5},
+ 124: {From: 0x2914, To: 0x351},
+ 125: {From: 0x2986, To: 0x2da7},
+ 126: {From: 0x29f0, To: 0x96b},
+ 127: {From: 0x2b1a, To: 0x38d},
+ 128: {From: 0x2bfc, To: 0x395},
+ 129: {From: 0x2c3f, To: 0x3caf},
+ 130: {From: 0x2ce1, To: 0x2201},
+ 131: {From: 0x2cfc, To: 0x3be},
+ 132: {From: 0x2d13, To: 0x597},
+ 133: {From: 0x2d47, To: 0x148},
+ 134: {From: 0x2d48, To: 0x148},
+ 135: {From: 0x2dff, To: 0x2f1},
+ 136: {From: 0x2e08, To: 0x19cc},
+ 137: {From: 0x2e10, To: 0xc45},
+ 138: {From: 0x2e1a, To: 0x2d95},
+ 139: {From: 0x2e21, To: 0x292},
+ 140: {From: 0x2e54, To: 0x7d},
+ 141: {From: 0x2e65, To: 0x2282},
+ 142: {From: 0x2e97, To: 0x1a4},
+ 143: {From: 0x2ea0, To: 0x2e9b},
+ 144: {From: 0x2eef, To: 0x2ed7},
+ 145: {From: 0x3193, To: 0x3c4},
+ 146: {From: 0x3366, To: 0x338e},
+ 147: {From: 0x342a, To: 0x3dc},
+ 148: {From: 0x34ee, To: 0x18d0},
+ 149: {From: 0x35c8, To: 0x2c9b},
+ 150: {From: 0x35e6, To: 0x412},
+ 151: {From: 0x35f5, To: 0x24b},
+ 152: {From: 0x360d, To: 0x1dc},
+ 153: {From: 0x3658, To: 0x246},
+ 154: {From: 0x3676, To: 0x3f4},
+ 155: {From: 0x36fd, To: 0x445},
+ 156: {From: 0x3747, To: 0x3b42},
+ 157: {From: 0x37c0, To: 0x121},
+ 158: {From: 0x3816, To: 0x38f2},
+ 159: {From: 0x382a, To: 0x2b48},
+ 160: {From: 0x382b, To: 0x2c9b},
+ 161: {From: 0x382f, To: 0xa9},
+ 162: {From: 0x3832, To: 0x3228},
+ 163: {From: 0x386c, To: 0x39a6},
+ 164: {From: 0x3892, To: 0x3fc0},
+ 165: {From: 0x38a0, To: 0x45f},
+ 166: {From: 0x38a5, To: 0x39d7},
+ 167: {From: 0x38b4, To: 0x1fa4},
+ 168: {From: 0x38b5, To: 0x2e9a},
+ 169: {From: 0x38fa, To: 0x38f1},
+ 170: {From: 0x395c, To: 0x47e},
+ 171: {From: 0x3b4e, To: 0xd91},
+ 172: {From: 0x3b78, To: 0x137},
+ 173: {From: 0x3c99, To: 0x4bc},
+ 174: {From: 0x3fbd, To: 0x100},
+ 175: {From: 0x4208, To: 0xa91},
+ 176: {From: 0x42be, To: 0x573},
+ 177: {From: 0x42f9, To: 0x3f60},
+ 178: {From: 0x4378, To: 0x25a},
+ 179: {From: 0x43b8, To: 0xe6c},
+ 180: {From: 0x43cd, To: 0x10f},
+ 181: {From: 0x43d4, To: 0x4848},
+ 182: {From: 0x44af, To: 0x3322},
+ 183: {From: 0x44e3, To: 0x512},
+ 184: {From: 0x45ca, To: 0x2409},
+ 185: {From: 0x45dd, To: 0x26dc},
+ 186: {From: 0x4610, To: 0x48ae},
+ 187: {From: 0x46ae, To: 0x46a0},
+ 188: {From: 0x473e, To: 0x4745},
+ 189: {From: 0x4817, To: 0x3503},
+ 190: {From: 0x483b, To: 0x208b},
+ 191: {From: 0x4916, To: 0x31f},
+ 192: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 193 bytes, 193 elements
+var AliasTypes = [193]AliasType{
+ // Entry 0 - 3F
+ 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0,
+ 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0,
+ 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1,
+ 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1,
+ // Entry 40 - 7F
+ 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0,
+ 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0,
+ 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+ // Entry 80 - BF
+ 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0,
+ 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0,
+ 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0,
+ 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1,
+ // Entry C0 - FF
+ 1,
+}
+
+const (
+ _Latn = 91
+ _Hani = 57
+ _Hans = 59
+ _Hant = 60
+ _Qaaa = 149
+ _Qaai = 157
+ _Qabx = 198
+ _Zinh = 255
+ _Zyyy = 260
+ _Zzzz = 261
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 1052 bytes
+ "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+ "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" +
+ "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" +
+ "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" +
+ "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" +
+ "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" +
+ "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" +
+ "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" +
+ "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
+ "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
+ "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
+ "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" +
+ "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" +
+ "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" +
+ "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists. If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry C0 - FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00,
+ // Entry 140 - 17F
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 380 - 3BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+ // Entry 3C0 - 3FF
+ 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 400 - 43F
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ // Entry 440 - 47F
+ 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ // Entry 480 - 4BF
+ 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 4C0 - 4FF
+ 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 500 - 53F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00,
+}
+
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 111
+ _GB = 124
+ _MD = 189
+ _PT = 239
+ _UK = 307
+ _US = 310
+ _ZZ = 358
+ _XA = 324
+ _XC = 326
+ _XK = 334
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 359 bytes, 359 elements
+var regionTypes = [359]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 40 - 7F
+ 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06,
+ 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 80 - BF
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry C0 - FF
+ 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ // Entry 100 - 13F
+ 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ // Entry 140 - 17F
+ 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06,
+ 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+// - [A-Z}{2}: the first letter of the 2-letter code plus these two
+// letters form the 3-letter ISO code.
+// - 0, n: index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1312 bytes
+ "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+ "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+ "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+ "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" +
+ "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" +
+ "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" +
+ "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" +
+ "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" +
+ "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" +
+ "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" +
+ "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" +
+ "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" +
+ "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" +
+ "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" +
+ "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" +
+ "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" +
+ "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" +
+ "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" +
+ "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" +
+ "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+ 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106,
+ 0x0122, 0x0160, 0x00dd,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+ 0: {From: 0x44, To: 0xc5},
+ 1: {From: 0x59, To: 0xa8},
+ 2: {From: 0x60, To: 0x61},
+ 3: {From: 0x67, To: 0x3b},
+ 4: {From: 0x7a, To: 0x79},
+ 5: {From: 0x94, To: 0x37},
+ 6: {From: 0xa4, To: 0x134},
+ 7: {From: 0xc2, To: 0x134},
+ 8: {From: 0xd8, To: 0x140},
+ 9: {From: 0xdd, To: 0x2b},
+ 10: {From: 0xf0, To: 0x134},
+ 11: {From: 0xf3, To: 0xe3},
+ 12: {From: 0xfd, To: 0x71},
+ 13: {From: 0x104, To: 0x165},
+ 14: {From: 0x12b, To: 0x127},
+ 15: {From: 0x133, To: 0x7c},
+ 16: {From: 0x13b, To: 0x13f},
+ 17: {From: 0x142, To: 0x134},
+ 18: {From: 0x15e, To: 0x15f},
+ 19: {From: 0x164, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 718 bytes, 359 elements
+var m49 = [359]int16{
+ // Entry 0 - 3F
+ 0, 1, 2, 3, 5, 9, 11, 13,
+ 14, 15, 17, 18, 19, 21, 29, 30,
+ 34, 35, 39, 53, 54, 57, 61, 142,
+ 143, 145, 150, 151, 154, 155, 202, 419,
+ 958, 0, 20, 784, 4, 28, 660, 8,
+ 51, 530, 24, 10, 32, 16, 40, 36,
+ 533, 248, 31, 70, 52, 50, 56, 854,
+ 100, 48, 108, 204, 652, 60, 96, 68,
+ // Entry 40 - 7F
+ 535, 76, 44, 64, 104, 74, 72, 112,
+ 84, 124, 166, 180, 140, 178, 756, 384,
+ 184, 152, 120, 156, 170, 0, 0, 188,
+ 891, 296, 192, 132, 531, 162, 196, 203,
+ 278, 276, 0, 262, 208, 212, 214, 204,
+ 12, 0, 218, 233, 818, 732, 232, 724,
+ 231, 967, 0, 246, 242, 238, 583, 234,
+ 0, 250, 249, 266, 826, 308, 268, 254,
+ // Entry 80 - BF
+ 831, 288, 292, 304, 270, 324, 312, 226,
+ 300, 239, 320, 316, 624, 328, 344, 334,
+ 340, 191, 332, 348, 854, 0, 360, 372,
+ 376, 833, 356, 86, 368, 364, 352, 380,
+ 832, 388, 400, 392, 581, 404, 417, 116,
+ 296, 174, 659, 408, 410, 414, 136, 398,
+ 418, 422, 662, 438, 144, 430, 426, 440,
+ 442, 428, 434, 504, 492, 498, 499, 663,
+ // Entry C0 - FF
+ 450, 584, 581, 807, 466, 104, 496, 446,
+ 580, 474, 478, 500, 470, 480, 462, 454,
+ 484, 458, 508, 516, 540, 562, 574, 566,
+ 548, 558, 528, 578, 524, 10, 520, 536,
+ 570, 554, 512, 591, 0, 604, 258, 598,
+ 608, 586, 616, 666, 612, 630, 275, 620,
+ 581, 585, 600, 591, 634, 959, 960, 961,
+ 962, 963, 964, 965, 966, 967, 968, 969,
+ // Entry 100 - 13F
+ 970, 971, 972, 638, 716, 642, 688, 643,
+ 646, 682, 90, 690, 729, 752, 702, 654,
+ 705, 744, 703, 694, 674, 686, 706, 740,
+ 728, 678, 810, 222, 534, 760, 748, 0,
+ 796, 148, 260, 768, 764, 762, 772, 626,
+ 795, 788, 776, 626, 792, 780, 798, 158,
+ 834, 804, 800, 826, 581, 0, 840, 858,
+ 860, 336, 670, 704, 862, 92, 850, 704,
+ // Entry 140 - 17F
+ 548, 876, 581, 882, 973, 974, 975, 976,
+ 977, 978, 979, 980, 981, 982, 983, 984,
+ 985, 986, 987, 988, 989, 990, 991, 992,
+ 993, 994, 995, 996, 997, 998, 720, 887,
+ 175, 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//
+// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+//
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+ 0, 59, 108, 143, 181, 220, 259, 291,
+ 333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+ // Entry 0 - 3F
+ 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+ 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+ 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+ 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+ 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+ 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+ 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047,
+ 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18,
+ // Entry 40 - 7F
+ 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+ 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d,
+ 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f,
+ 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70,
+ 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73,
+ 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b,
+ 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882,
+ 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885,
+ // Entry 80 - BF
+ 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e,
+ 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f,
+ 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad,
+ 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba,
+ 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce,
+ 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6,
+ 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de,
+ 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df,
+ // Entry C0 - FF
+ 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6,
+ 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3,
+ 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c,
+ 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c,
+ 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514,
+ 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12,
+ 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118,
+ 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e,
+ // Entry 100 - 13F
+ 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023,
+ 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3,
+ 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136,
+ 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f,
+ 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8,
+ 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500,
+ 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549,
+ 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551,
+ // Entry 140 - 17F
+ 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559,
+ 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66,
+}
+
+// Size: 2128 bytes
+var variantIndex = map[string]uint8{
+ "1606nict": 0x0,
+ "1694acad": 0x1,
+ "1901": 0x2,
+ "1959acad": 0x3,
+ "1994": 0x67,
+ "1996": 0x4,
+ "abl1943": 0x5,
+ "akuapem": 0x6,
+ "alalc97": 0x69,
+ "aluku": 0x7,
+ "ao1990": 0x8,
+ "aranes": 0x9,
+ "arevela": 0xa,
+ "arevmda": 0xb,
+ "arkaika": 0xc,
+ "asante": 0xd,
+ "auvern": 0xe,
+ "baku1926": 0xf,
+ "balanka": 0x10,
+ "barla": 0x11,
+ "basiceng": 0x12,
+ "bauddha": 0x13,
+ "bciav": 0x14,
+ "bcizbl": 0x15,
+ "biscayan": 0x16,
+ "biske": 0x62,
+ "bohoric": 0x17,
+ "boont": 0x18,
+ "bornholm": 0x19,
+ "cisaup": 0x1a,
+ "colb1945": 0x1b,
+ "cornu": 0x1c,
+ "creiss": 0x1d,
+ "dajnko": 0x1e,
+ "ekavsk": 0x1f,
+ "emodeng": 0x20,
+ "fonipa": 0x6a,
+ "fonkirsh": 0x6b,
+ "fonnapa": 0x6c,
+ "fonupa": 0x6d,
+ "fonxsamp": 0x6e,
+ "gallo": 0x21,
+ "gascon": 0x22,
+ "grclass": 0x23,
+ "grital": 0x24,
+ "grmistr": 0x25,
+ "hepburn": 0x26,
+ "heploc": 0x68,
+ "hognorsk": 0x27,
+ "hsistemo": 0x28,
+ "ijekavsk": 0x29,
+ "itihasa": 0x2a,
+ "ivanchov": 0x2b,
+ "jauer": 0x2c,
+ "jyutping": 0x2d,
+ "kkcor": 0x2e,
+ "kociewie": 0x2f,
+ "kscor": 0x30,
+ "laukika": 0x31,
+ "lemosin": 0x32,
+ "lengadoc": 0x33,
+ "lipaw": 0x63,
+ "ltg1929": 0x34,
+ "ltg2007": 0x35,
+ "luna1918": 0x36,
+ "metelko": 0x37,
+ "monoton": 0x38,
+ "ndyuka": 0x39,
+ "nedis": 0x3a,
+ "newfound": 0x3b,
+ "nicard": 0x3c,
+ "njiva": 0x64,
+ "nulik": 0x3d,
+ "osojs": 0x65,
+ "oxendict": 0x3e,
+ "pahawh2": 0x3f,
+ "pahawh3": 0x40,
+ "pahawh4": 0x41,
+ "pamaka": 0x42,
+ "peano": 0x43,
+ "petr1708": 0x44,
+ "pinyin": 0x45,
+ "polyton": 0x46,
+ "provenc": 0x47,
+ "puter": 0x48,
+ "rigik": 0x49,
+ "rozaj": 0x4a,
+ "rumgr": 0x4b,
+ "scotland": 0x4c,
+ "scouse": 0x4d,
+ "simple": 0x6f,
+ "solba": 0x66,
+ "sotav": 0x4e,
+ "spanglis": 0x4f,
+ "surmiran": 0x50,
+ "sursilv": 0x51,
+ "sutsilv": 0x52,
+ "synnejyl": 0x53,
+ "tarask": 0x54,
+ "tongyong": 0x55,
+ "tunumiit": 0x56,
+ "uccor": 0x57,
+ "ucrcor": 0x58,
+ "ulster": 0x59,
+ "unifon": 0x5a,
+ "vaidika": 0x5b,
+ "valencia": 0x5c,
+ "vallader": 0x5d,
+ "vecdruka": 0x5e,
+ "vivaraup": 0x5f,
+ "wadegile": 0x60,
+ "xsistemo": 0x61,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 105
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+ lang uint16
+ region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 1052 bytes, 263 elements
+var likelyScript = [263]likelyLangRegion{
+ 1: {lang: 0x14e, region: 0x85},
+ 3: {lang: 0x2a2, region: 0x107},
+ 4: {lang: 0x1f, region: 0x9a},
+ 5: {lang: 0x3a, region: 0x6c},
+ 7: {lang: 0x3b, region: 0x9d},
+ 8: {lang: 0x1d7, region: 0x28},
+ 9: {lang: 0x13, region: 0x9d},
+ 10: {lang: 0x5b, region: 0x96},
+ 11: {lang: 0x60, region: 0x52},
+ 12: {lang: 0xb9, region: 0xb5},
+ 13: {lang: 0x63, region: 0x96},
+ 14: {lang: 0xa5, region: 0x35},
+ 15: {lang: 0x3e9, region: 0x9a},
+ 17: {lang: 0x529, region: 0x12f},
+ 18: {lang: 0x3b1, region: 0x9a},
+ 19: {lang: 0x15e, region: 0x79},
+ 20: {lang: 0xc2, region: 0x96},
+ 21: {lang: 0x9d, region: 0xe8},
+ 22: {lang: 0xdb, region: 0x35},
+ 23: {lang: 0xf3, region: 0x49},
+ 24: {lang: 0x4f0, region: 0x12c},
+ 25: {lang: 0xe7, region: 0x13f},
+ 26: {lang: 0xe5, region: 0x136},
+ 29: {lang: 0xf1, region: 0x6c},
+ 31: {lang: 0x1a0, region: 0x5e},
+ 32: {lang: 0x3e2, region: 0x107},
+ 34: {lang: 0x1be, region: 0x9a},
+ 38: {lang: 0x15e, region: 0x79},
+ 41: {lang: 0x133, region: 0x6c},
+ 42: {lang: 0x431, region: 0x27},
+ 44: {lang: 0x27, region: 0x70},
+ 46: {lang: 0x210, region: 0x7e},
+ 47: {lang: 0xfe, region: 0x38},
+ 49: {lang: 0x19b, region: 0x9a},
+ 50: {lang: 0x19e, region: 0x131},
+ 51: {lang: 0x3e9, region: 0x9a},
+ 52: {lang: 0x136, region: 0x88},
+ 53: {lang: 0x1a4, region: 0x9a},
+ 54: {lang: 0x39d, region: 0x9a},
+ 55: {lang: 0x529, region: 0x12f},
+ 56: {lang: 0x254, region: 0xac},
+ 57: {lang: 0x529, region: 0x53},
+ 58: {lang: 0x1cb, region: 0xe8},
+ 59: {lang: 0x529, region: 0x53},
+ 60: {lang: 0x529, region: 0x12f},
+ 61: {lang: 0x2fd, region: 0x9c},
+ 62: {lang: 0x1bc, region: 0x98},
+ 63: {lang: 0x200, region: 0xa3},
+ 64: {lang: 0x1c5, region: 0x12c},
+ 65: {lang: 0x1ca, region: 0xb0},
+ 68: {lang: 0x1d5, region: 0x93},
+ 70: {lang: 0x142, region: 0x9f},
+ 71: {lang: 0x254, region: 0xac},
+ 72: {lang: 0x20e, region: 0x96},
+ 73: {lang: 0x200, region: 0xa3},
+ 75: {lang: 0x135, region: 0xc5},
+ 76: {lang: 0x200, region: 0xa3},
+ 78: {lang: 0x3bb, region: 0xe9},
+ 79: {lang: 0x24a, region: 0xa7},
+ 80: {lang: 0x3fa, region: 0x9a},
+ 83: {lang: 0x251, region: 0x9a},
+ 84: {lang: 0x254, region: 0xac},
+ 86: {lang: 0x88, region: 0x9a},
+ 87: {lang: 0x370, region: 0x124},
+ 88: {lang: 0x2b8, region: 0xb0},
+ 93: {lang: 0x29f, region: 0x9a},
+ 94: {lang: 0x2a8, region: 0x9a},
+ 95: {lang: 0x28f, region: 0x88},
+ 96: {lang: 0x1a0, region: 0x88},
+ 97: {lang: 0x2ac, region: 0x53},
+ 99: {lang: 0x4f4, region: 0x12c},
+ 100: {lang: 0x4f5, region: 0x12c},
+ 101: {lang: 0x1be, region: 0x9a},
+ 103: {lang: 0x337, region: 0x9d},
+ 104: {lang: 0x4f7, region: 0x53},
+ 105: {lang: 0xa9, region: 0x53},
+ 108: {lang: 0x2e8, region: 0x113},
+ 109: {lang: 0x4f8, region: 0x10c},
+ 110: {lang: 0x4f8, region: 0x10c},
+ 111: {lang: 0x304, region: 0x9a},
+ 112: {lang: 0x31b, region: 0x9a},
+ 113: {lang: 0x30b, region: 0x53},
+ 115: {lang: 0x31e, region: 0x35},
+ 116: {lang: 0x30e, region: 0x9a},
+ 117: {lang: 0x414, region: 0xe9},
+ 118: {lang: 0x331, region: 0xc5},
+ 121: {lang: 0x4f9, region: 0x109},
+ 122: {lang: 0x3b, region: 0xa2},
+ 123: {lang: 0x353, region: 0xdc},
+ 126: {lang: 0x2d0, region: 0x85},
+ 127: {lang: 0x52a, region: 0x53},
+ 128: {lang: 0x403, region: 0x97},
+ 129: {lang: 0x3ee, region: 0x9a},
+ 130: {lang: 0x39b, region: 0xc6},
+ 131: {lang: 0x395, region: 0x9a},
+ 132: {lang: 0x399, region: 0x136},
+ 133: {lang: 0x429, region: 0x116},
+ 135: {lang: 0x3b, region: 0x11d},
+ 136: {lang: 0xfd, region: 0xc5},
+ 139: {lang: 0x27d, region: 0x107},
+ 140: {lang: 0x2c9, region: 0x53},
+ 141: {lang: 0x39f, region: 0x9d},
+ 142: {lang: 0x39f, region: 0x53},
+ 144: {lang: 0x3ad, region: 0xb1},
+ 146: {lang: 0x1c6, region: 0x53},
+ 147: {lang: 0x4fd, region: 0x9d},
+ 200: {lang: 0x3cb, region: 0x96},
+ 203: {lang: 0x372, region: 0x10d},
+ 204: {lang: 0x420, region: 0x98},
+ 206: {lang: 0x4ff, region: 0x15f},
+ 207: {lang: 0x3f0, region: 0x9a},
+ 208: {lang: 0x45, region: 0x136},
+ 209: {lang: 0x139, region: 0x7c},
+ 210: {lang: 0x3e9, region: 0x9a},
+ 212: {lang: 0x3e9, region: 0x9a},
+ 213: {lang: 0x3fa, region: 0x9a},
+ 214: {lang: 0x40c, region: 0xb4},
+ 217: {lang: 0x433, region: 0x9a},
+ 218: {lang: 0xef, region: 0xc6},
+ 219: {lang: 0x43e, region: 0x96},
+ 221: {lang: 0x44d, region: 0x35},
+ 222: {lang: 0x44e, region: 0x9c},
+ 226: {lang: 0x45a, region: 0xe8},
+ 227: {lang: 0x11a, region: 0x9a},
+ 228: {lang: 0x45e, region: 0x53},
+ 229: {lang: 0x232, region: 0x53},
+ 230: {lang: 0x450, region: 0x9a},
+ 231: {lang: 0x4a5, region: 0x53},
+ 232: {lang: 0x9f, region: 0x13f},
+ 233: {lang: 0x461, region: 0x9a},
+ 235: {lang: 0x528, region: 0xbb},
+ 236: {lang: 0x153, region: 0xe8},
+ 237: {lang: 0x128, region: 0xce},
+ 238: {lang: 0x46b, region: 0x124},
+ 239: {lang: 0xa9, region: 0x53},
+ 240: {lang: 0x2ce, region: 0x9a},
+ 243: {lang: 0x4ad, region: 0x11d},
+ 244: {lang: 0x4be, region: 0xb5},
+ 247: {lang: 0x1ce, region: 0x9a},
+ 250: {lang: 0x3a9, region: 0x9d},
+ 251: {lang: 0x22, region: 0x9c},
+ 253: {lang: 0x1ea, region: 0x53},
+ 254: {lang: 0xef, region: 0xc6},
+}
+
+type likelyScriptRegion struct {
+ region uint16
+ script uint16
+ flags uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 7980 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+ 0: {region: 0x136, script: 0x5b, flags: 0x0},
+ 1: {region: 0x70, script: 0x5b, flags: 0x0},
+ 2: {region: 0x166, script: 0x5b, flags: 0x0},
+ 3: {region: 0x166, script: 0x5b, flags: 0x0},
+ 4: {region: 0x166, script: 0x5b, flags: 0x0},
+ 5: {region: 0x7e, script: 0x20, flags: 0x0},
+ 6: {region: 0x166, script: 0x5b, flags: 0x0},
+ 7: {region: 0x166, script: 0x20, flags: 0x0},
+ 8: {region: 0x81, script: 0x5b, flags: 0x0},
+ 9: {region: 0x166, script: 0x5b, flags: 0x0},
+ 10: {region: 0x166, script: 0x5b, flags: 0x0},
+ 11: {region: 0x166, script: 0x5b, flags: 0x0},
+ 12: {region: 0x96, script: 0x5b, flags: 0x0},
+ 13: {region: 0x132, script: 0x5b, flags: 0x0},
+ 14: {region: 0x81, script: 0x5b, flags: 0x0},
+ 15: {region: 0x166, script: 0x5b, flags: 0x0},
+ 16: {region: 0x166, script: 0x5b, flags: 0x0},
+ 17: {region: 0x107, script: 0x20, flags: 0x0},
+ 18: {region: 0x166, script: 0x5b, flags: 0x0},
+ 19: {region: 0x9d, script: 0x9, flags: 0x0},
+ 20: {region: 0x129, script: 0x5, flags: 0x0},
+ 21: {region: 0x166, script: 0x5b, flags: 0x0},
+ 22: {region: 0x162, script: 0x5b, flags: 0x0},
+ 23: {region: 0x166, script: 0x5b, flags: 0x0},
+ 24: {region: 0x166, script: 0x5b, flags: 0x0},
+ 25: {region: 0x166, script: 0x5b, flags: 0x0},
+ 26: {region: 0x166, script: 0x5b, flags: 0x0},
+ 27: {region: 0x166, script: 0x5b, flags: 0x0},
+ 28: {region: 0x52, script: 0x5b, flags: 0x0},
+ 29: {region: 0x166, script: 0x5b, flags: 0x0},
+ 30: {region: 0x166, script: 0x5b, flags: 0x0},
+ 31: {region: 0x9a, script: 0x4, flags: 0x0},
+ 32: {region: 0x166, script: 0x5b, flags: 0x0},
+ 33: {region: 0x81, script: 0x5b, flags: 0x0},
+ 34: {region: 0x9c, script: 0xfb, flags: 0x0},
+ 35: {region: 0x166, script: 0x5b, flags: 0x0},
+ 36: {region: 0x166, script: 0x5b, flags: 0x0},
+ 37: {region: 0x14e, script: 0x5b, flags: 0x0},
+ 38: {region: 0x107, script: 0x20, flags: 0x0},
+ 39: {region: 0x70, script: 0x2c, flags: 0x0},
+ 40: {region: 0x166, script: 0x5b, flags: 0x0},
+ 41: {region: 0x166, script: 0x5b, flags: 0x0},
+ 42: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 43: {region: 0x166, script: 0x5b, flags: 0x0},
+ 45: {region: 0x166, script: 0x5b, flags: 0x0},
+ 46: {region: 0x166, script: 0x5b, flags: 0x0},
+ 47: {region: 0x166, script: 0x5b, flags: 0x0},
+ 48: {region: 0x166, script: 0x5b, flags: 0x0},
+ 49: {region: 0x166, script: 0x5b, flags: 0x0},
+ 50: {region: 0x166, script: 0x5b, flags: 0x0},
+ 51: {region: 0x96, script: 0x5b, flags: 0x0},
+ 52: {region: 0x166, script: 0x5, flags: 0x0},
+ 53: {region: 0x123, script: 0x5, flags: 0x0},
+ 54: {region: 0x166, script: 0x5b, flags: 0x0},
+ 55: {region: 0x166, script: 0x5b, flags: 0x0},
+ 56: {region: 0x166, script: 0x5b, flags: 0x0},
+ 57: {region: 0x166, script: 0x5b, flags: 0x0},
+ 58: {region: 0x6c, script: 0x5, flags: 0x0},
+ 59: {region: 0x0, script: 0x3, flags: 0x1},
+ 60: {region: 0x166, script: 0x5b, flags: 0x0},
+ 61: {region: 0x51, script: 0x5b, flags: 0x0},
+ 62: {region: 0x3f, script: 0x5b, flags: 0x0},
+ 63: {region: 0x68, script: 0x5, flags: 0x0},
+ 65: {region: 0xbb, script: 0x5, flags: 0x0},
+ 66: {region: 0x6c, script: 0x5, flags: 0x0},
+ 67: {region: 0x9a, script: 0xe, flags: 0x0},
+ 68: {region: 0x130, script: 0x5b, flags: 0x0},
+ 69: {region: 0x136, script: 0xd0, flags: 0x0},
+ 70: {region: 0x166, script: 0x5b, flags: 0x0},
+ 71: {region: 0x166, script: 0x5b, flags: 0x0},
+ 72: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 73: {region: 0x166, script: 0x5b, flags: 0x0},
+ 74: {region: 0x166, script: 0x5b, flags: 0x0},
+ 75: {region: 0x49, script: 0x5b, flags: 0x0},
+ 76: {region: 0x166, script: 0x5b, flags: 0x0},
+ 77: {region: 0x107, script: 0x20, flags: 0x0},
+ 78: {region: 0x166, script: 0x5, flags: 0x0},
+ 79: {region: 0x166, script: 0x5b, flags: 0x0},
+ 80: {region: 0x166, script: 0x5b, flags: 0x0},
+ 81: {region: 0x166, script: 0x5b, flags: 0x0},
+ 82: {region: 0x9a, script: 0x22, flags: 0x0},
+ 83: {region: 0x166, script: 0x5b, flags: 0x0},
+ 84: {region: 0x166, script: 0x5b, flags: 0x0},
+ 85: {region: 0x166, script: 0x5b, flags: 0x0},
+ 86: {region: 0x3f, script: 0x5b, flags: 0x0},
+ 87: {region: 0x166, script: 0x5b, flags: 0x0},
+ 88: {region: 0x3, script: 0x5, flags: 0x1},
+ 89: {region: 0x107, script: 0x20, flags: 0x0},
+ 90: {region: 0xe9, script: 0x5, flags: 0x0},
+ 91: {region: 0x96, script: 0x5b, flags: 0x0},
+ 92: {region: 0xdc, script: 0x22, flags: 0x0},
+ 93: {region: 0x2e, script: 0x5b, flags: 0x0},
+ 94: {region: 0x52, script: 0x5b, flags: 0x0},
+ 95: {region: 0x166, script: 0x5b, flags: 0x0},
+ 96: {region: 0x52, script: 0xb, flags: 0x0},
+ 97: {region: 0x166, script: 0x5b, flags: 0x0},
+ 98: {region: 0x166, script: 0x5b, flags: 0x0},
+ 99: {region: 0x96, script: 0x5b, flags: 0x0},
+ 100: {region: 0x166, script: 0x5b, flags: 0x0},
+ 101: {region: 0x52, script: 0x5b, flags: 0x0},
+ 102: {region: 0x166, script: 0x5b, flags: 0x0},
+ 103: {region: 0x166, script: 0x5b, flags: 0x0},
+ 104: {region: 0x166, script: 0x5b, flags: 0x0},
+ 105: {region: 0x166, script: 0x5b, flags: 0x0},
+ 106: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 107: {region: 0x166, script: 0x5b, flags: 0x0},
+ 108: {region: 0x166, script: 0x5b, flags: 0x0},
+ 109: {region: 0x166, script: 0x5b, flags: 0x0},
+ 110: {region: 0x166, script: 0x2c, flags: 0x0},
+ 111: {region: 0x166, script: 0x5b, flags: 0x0},
+ 112: {region: 0x166, script: 0x5b, flags: 0x0},
+ 113: {region: 0x47, script: 0x20, flags: 0x0},
+ 114: {region: 0x166, script: 0x5b, flags: 0x0},
+ 115: {region: 0x166, script: 0x5b, flags: 0x0},
+ 116: {region: 0x10c, script: 0x5, flags: 0x0},
+ 117: {region: 0x163, script: 0x5b, flags: 0x0},
+ 118: {region: 0x166, script: 0x5b, flags: 0x0},
+ 119: {region: 0x96, script: 0x5b, flags: 0x0},
+ 120: {region: 0x166, script: 0x5b, flags: 0x0},
+ 121: {region: 0x130, script: 0x5b, flags: 0x0},
+ 122: {region: 0x52, script: 0x5b, flags: 0x0},
+ 123: {region: 0x9a, script: 0xe6, flags: 0x0},
+ 124: {region: 0xe9, script: 0x5, flags: 0x0},
+ 125: {region: 0x9a, script: 0x22, flags: 0x0},
+ 126: {region: 0x38, script: 0x20, flags: 0x0},
+ 127: {region: 0x9a, script: 0x22, flags: 0x0},
+ 128: {region: 0xe9, script: 0x5, flags: 0x0},
+ 129: {region: 0x12c, script: 0x34, flags: 0x0},
+ 131: {region: 0x9a, script: 0x22, flags: 0x0},
+ 132: {region: 0x166, script: 0x5b, flags: 0x0},
+ 133: {region: 0x9a, script: 0x22, flags: 0x0},
+ 134: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 135: {region: 0x166, script: 0x5b, flags: 0x0},
+ 136: {region: 0x9a, script: 0x22, flags: 0x0},
+ 137: {region: 0x166, script: 0x5b, flags: 0x0},
+ 138: {region: 0x140, script: 0x5b, flags: 0x0},
+ 139: {region: 0x166, script: 0x5b, flags: 0x0},
+ 140: {region: 0x166, script: 0x5b, flags: 0x0},
+ 141: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 142: {region: 0x166, script: 0x5b, flags: 0x0},
+ 143: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 144: {region: 0x166, script: 0x5b, flags: 0x0},
+ 145: {region: 0x166, script: 0x5b, flags: 0x0},
+ 146: {region: 0x166, script: 0x5b, flags: 0x0},
+ 147: {region: 0x166, script: 0x2c, flags: 0x0},
+ 148: {region: 0x9a, script: 0x22, flags: 0x0},
+ 149: {region: 0x96, script: 0x5b, flags: 0x0},
+ 150: {region: 0x166, script: 0x5b, flags: 0x0},
+ 151: {region: 0x166, script: 0x5b, flags: 0x0},
+ 152: {region: 0x115, script: 0x5b, flags: 0x0},
+ 153: {region: 0x166, script: 0x5b, flags: 0x0},
+ 154: {region: 0x166, script: 0x5b, flags: 0x0},
+ 155: {region: 0x52, script: 0x5b, flags: 0x0},
+ 156: {region: 0x166, script: 0x5b, flags: 0x0},
+ 157: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 158: {region: 0x166, script: 0x5b, flags: 0x0},
+ 159: {region: 0x13f, script: 0xe8, flags: 0x0},
+ 160: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 161: {region: 0x166, script: 0x5b, flags: 0x0},
+ 162: {region: 0x166, script: 0x5b, flags: 0x0},
+ 163: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 164: {region: 0x166, script: 0x5b, flags: 0x0},
+ 165: {region: 0x35, script: 0xe, flags: 0x0},
+ 166: {region: 0x166, script: 0x5b, flags: 0x0},
+ 167: {region: 0x166, script: 0x5b, flags: 0x0},
+ 168: {region: 0x166, script: 0x5b, flags: 0x0},
+ 169: {region: 0x53, script: 0xef, flags: 0x0},
+ 170: {region: 0x166, script: 0x5b, flags: 0x0},
+ 171: {region: 0x166, script: 0x5b, flags: 0x0},
+ 172: {region: 0x166, script: 0x5b, flags: 0x0},
+ 173: {region: 0x9a, script: 0xe, flags: 0x0},
+ 174: {region: 0x166, script: 0x5b, flags: 0x0},
+ 175: {region: 0x9d, script: 0x5, flags: 0x0},
+ 176: {region: 0x166, script: 0x5b, flags: 0x0},
+ 177: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 178: {region: 0x79, script: 0x5b, flags: 0x0},
+ 179: {region: 0x9a, script: 0x22, flags: 0x0},
+ 180: {region: 0xe9, script: 0x5, flags: 0x0},
+ 181: {region: 0x9a, script: 0x22, flags: 0x0},
+ 182: {region: 0x166, script: 0x5b, flags: 0x0},
+ 183: {region: 0x33, script: 0x5b, flags: 0x0},
+ 184: {region: 0x166, script: 0x5b, flags: 0x0},
+ 185: {region: 0xb5, script: 0xc, flags: 0x0},
+ 186: {region: 0x52, script: 0x5b, flags: 0x0},
+ 187: {region: 0x166, script: 0x2c, flags: 0x0},
+ 188: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 189: {region: 0x166, script: 0x5b, flags: 0x0},
+ 190: {region: 0xe9, script: 0x22, flags: 0x0},
+ 191: {region: 0x107, script: 0x20, flags: 0x0},
+ 192: {region: 0x160, script: 0x5b, flags: 0x0},
+ 193: {region: 0x166, script: 0x5b, flags: 0x0},
+ 194: {region: 0x96, script: 0x5b, flags: 0x0},
+ 195: {region: 0x166, script: 0x5b, flags: 0x0},
+ 196: {region: 0x52, script: 0x5b, flags: 0x0},
+ 197: {region: 0x166, script: 0x5b, flags: 0x0},
+ 198: {region: 0x166, script: 0x5b, flags: 0x0},
+ 199: {region: 0x166, script: 0x5b, flags: 0x0},
+ 200: {region: 0x87, script: 0x5b, flags: 0x0},
+ 201: {region: 0x166, script: 0x5b, flags: 0x0},
+ 202: {region: 0x166, script: 0x5b, flags: 0x0},
+ 203: {region: 0x166, script: 0x5b, flags: 0x0},
+ 204: {region: 0x166, script: 0x5b, flags: 0x0},
+ 205: {region: 0x6e, script: 0x2c, flags: 0x0},
+ 206: {region: 0x166, script: 0x5b, flags: 0x0},
+ 207: {region: 0x166, script: 0x5b, flags: 0x0},
+ 208: {region: 0x52, script: 0x5b, flags: 0x0},
+ 209: {region: 0x166, script: 0x5b, flags: 0x0},
+ 210: {region: 0x166, script: 0x5b, flags: 0x0},
+ 211: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 212: {region: 0x166, script: 0x5b, flags: 0x0},
+ 213: {region: 0x166, script: 0x5b, flags: 0x0},
+ 214: {region: 0x166, script: 0x5b, flags: 0x0},
+ 215: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 216: {region: 0x166, script: 0x5b, flags: 0x0},
+ 217: {region: 0x166, script: 0x5b, flags: 0x0},
+ 218: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 219: {region: 0x35, script: 0x16, flags: 0x0},
+ 220: {region: 0x107, script: 0x20, flags: 0x0},
+ 221: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 222: {region: 0x166, script: 0x5b, flags: 0x0},
+ 223: {region: 0x132, script: 0x5b, flags: 0x0},
+ 224: {region: 0x8b, script: 0x5b, flags: 0x0},
+ 225: {region: 0x76, script: 0x5b, flags: 0x0},
+ 226: {region: 0x107, script: 0x20, flags: 0x0},
+ 227: {region: 0x136, script: 0x5b, flags: 0x0},
+ 228: {region: 0x49, script: 0x5b, flags: 0x0},
+ 229: {region: 0x136, script: 0x1a, flags: 0x0},
+ 230: {region: 0xa7, script: 0x5, flags: 0x0},
+ 231: {region: 0x13f, script: 0x19, flags: 0x0},
+ 232: {region: 0x166, script: 0x5b, flags: 0x0},
+ 233: {region: 0x9c, script: 0x5, flags: 0x0},
+ 234: {region: 0x166, script: 0x5b, flags: 0x0},
+ 235: {region: 0x166, script: 0x5b, flags: 0x0},
+ 236: {region: 0x166, script: 0x5b, flags: 0x0},
+ 237: {region: 0x166, script: 0x5b, flags: 0x0},
+ 238: {region: 0x166, script: 0x5b, flags: 0x0},
+ 239: {region: 0xc6, script: 0xda, flags: 0x0},
+ 240: {region: 0x79, script: 0x5b, flags: 0x0},
+ 241: {region: 0x6c, script: 0x1d, flags: 0x0},
+ 242: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 243: {region: 0x49, script: 0x17, flags: 0x0},
+ 244: {region: 0x131, script: 0x20, flags: 0x0},
+ 245: {region: 0x49, script: 0x17, flags: 0x0},
+ 246: {region: 0x49, script: 0x17, flags: 0x0},
+ 247: {region: 0x49, script: 0x17, flags: 0x0},
+ 248: {region: 0x49, script: 0x17, flags: 0x0},
+ 249: {region: 0x10b, script: 0x5b, flags: 0x0},
+ 250: {region: 0x5f, script: 0x5b, flags: 0x0},
+ 251: {region: 0xea, script: 0x5b, flags: 0x0},
+ 252: {region: 0x49, script: 0x17, flags: 0x0},
+ 253: {region: 0xc5, script: 0x88, flags: 0x0},
+ 254: {region: 0x8, script: 0x2, flags: 0x1},
+ 255: {region: 0x107, script: 0x20, flags: 0x0},
+ 256: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 257: {region: 0x64, script: 0x5b, flags: 0x0},
+ 258: {region: 0x166, script: 0x5b, flags: 0x0},
+ 259: {region: 0x166, script: 0x5b, flags: 0x0},
+ 260: {region: 0x166, script: 0x5b, flags: 0x0},
+ 261: {region: 0x166, script: 0x5b, flags: 0x0},
+ 262: {region: 0x136, script: 0x5b, flags: 0x0},
+ 263: {region: 0x107, script: 0x20, flags: 0x0},
+ 264: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 265: {region: 0x166, script: 0x5b, flags: 0x0},
+ 266: {region: 0x166, script: 0x5b, flags: 0x0},
+ 267: {region: 0x9a, script: 0x5, flags: 0x0},
+ 268: {region: 0x166, script: 0x5b, flags: 0x0},
+ 269: {region: 0x61, script: 0x5b, flags: 0x0},
+ 270: {region: 0x166, script: 0x5b, flags: 0x0},
+ 271: {region: 0x49, script: 0x5b, flags: 0x0},
+ 272: {region: 0x166, script: 0x5b, flags: 0x0},
+ 273: {region: 0x166, script: 0x5b, flags: 0x0},
+ 274: {region: 0x166, script: 0x5b, flags: 0x0},
+ 275: {region: 0x166, script: 0x5, flags: 0x0},
+ 276: {region: 0x49, script: 0x5b, flags: 0x0},
+ 277: {region: 0x166, script: 0x5b, flags: 0x0},
+ 278: {region: 0x166, script: 0x5b, flags: 0x0},
+ 279: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 280: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 281: {region: 0x166, script: 0x5b, flags: 0x0},
+ 282: {region: 0x9a, script: 0x5, flags: 0x0},
+ 283: {region: 0x166, script: 0x5b, flags: 0x0},
+ 284: {region: 0x166, script: 0x5b, flags: 0x0},
+ 285: {region: 0x166, script: 0x5b, flags: 0x0},
+ 286: {region: 0x166, script: 0x2c, flags: 0x0},
+ 287: {region: 0x61, script: 0x5b, flags: 0x0},
+ 288: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 289: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 290: {region: 0x166, script: 0x5b, flags: 0x0},
+ 291: {region: 0xdc, script: 0x22, flags: 0x0},
+ 292: {region: 0x52, script: 0x5b, flags: 0x0},
+ 293: {region: 0x166, script: 0x5b, flags: 0x0},
+ 294: {region: 0x166, script: 0x5b, flags: 0x0},
+ 295: {region: 0x166, script: 0x5b, flags: 0x0},
+ 296: {region: 0xce, script: 0xed, flags: 0x0},
+ 297: {region: 0x166, script: 0x5b, flags: 0x0},
+ 298: {region: 0x166, script: 0x5b, flags: 0x0},
+ 299: {region: 0x115, script: 0x5b, flags: 0x0},
+ 300: {region: 0x37, script: 0x5b, flags: 0x0},
+ 301: {region: 0x43, script: 0xef, flags: 0x0},
+ 302: {region: 0x166, script: 0x5b, flags: 0x0},
+ 303: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 304: {region: 0x81, script: 0x5b, flags: 0x0},
+ 305: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 306: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 307: {region: 0x6c, script: 0x29, flags: 0x0},
+ 308: {region: 0x166, script: 0x5b, flags: 0x0},
+ 309: {region: 0xc5, script: 0x4b, flags: 0x0},
+ 310: {region: 0x88, script: 0x34, flags: 0x0},
+ 311: {region: 0x166, script: 0x5b, flags: 0x0},
+ 312: {region: 0x166, script: 0x5b, flags: 0x0},
+ 313: {region: 0xa, script: 0x2, flags: 0x1},
+ 314: {region: 0x166, script: 0x5b, flags: 0x0},
+ 315: {region: 0x166, script: 0x5b, flags: 0x0},
+ 316: {region: 0x1, script: 0x5b, flags: 0x0},
+ 317: {region: 0x166, script: 0x5b, flags: 0x0},
+ 318: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 319: {region: 0x136, script: 0x5b, flags: 0x0},
+ 320: {region: 0x6b, script: 0x5b, flags: 0x0},
+ 321: {region: 0x166, script: 0x5b, flags: 0x0},
+ 322: {region: 0x9f, script: 0x46, flags: 0x0},
+ 323: {region: 0x166, script: 0x5b, flags: 0x0},
+ 324: {region: 0x166, script: 0x5b, flags: 0x0},
+ 325: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 326: {region: 0x52, script: 0x5b, flags: 0x0},
+ 327: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 328: {region: 0x9d, script: 0x5, flags: 0x0},
+ 329: {region: 0x166, script: 0x5b, flags: 0x0},
+ 330: {region: 0x166, script: 0x5b, flags: 0x0},
+ 331: {region: 0x166, script: 0x5b, flags: 0x0},
+ 332: {region: 0x166, script: 0x5b, flags: 0x0},
+ 333: {region: 0x87, script: 0x5b, flags: 0x0},
+ 334: {region: 0xc, script: 0x2, flags: 0x1},
+ 335: {region: 0x166, script: 0x5b, flags: 0x0},
+ 336: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 337: {region: 0x73, script: 0x5b, flags: 0x0},
+ 338: {region: 0x10c, script: 0x5, flags: 0x0},
+ 339: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 340: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 341: {region: 0x74, script: 0x5b, flags: 0x0},
+ 342: {region: 0x166, script: 0x5b, flags: 0x0},
+ 343: {region: 0x166, script: 0x5b, flags: 0x0},
+ 344: {region: 0x77, script: 0x5b, flags: 0x0},
+ 345: {region: 0x166, script: 0x5b, flags: 0x0},
+ 346: {region: 0x3b, script: 0x5b, flags: 0x0},
+ 347: {region: 0x166, script: 0x5b, flags: 0x0},
+ 348: {region: 0x166, script: 0x5b, flags: 0x0},
+ 349: {region: 0x166, script: 0x5b, flags: 0x0},
+ 350: {region: 0x79, script: 0x5b, flags: 0x0},
+ 351: {region: 0x136, script: 0x5b, flags: 0x0},
+ 352: {region: 0x79, script: 0x5b, flags: 0x0},
+ 353: {region: 0x61, script: 0x5b, flags: 0x0},
+ 354: {region: 0x61, script: 0x5b, flags: 0x0},
+ 355: {region: 0x52, script: 0x5, flags: 0x0},
+ 356: {region: 0x141, script: 0x5b, flags: 0x0},
+ 357: {region: 0x166, script: 0x5b, flags: 0x0},
+ 358: {region: 0x85, script: 0x5b, flags: 0x0},
+ 359: {region: 0x166, script: 0x5b, flags: 0x0},
+ 360: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 361: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 362: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 363: {region: 0x166, script: 0x5b, flags: 0x0},
+ 364: {region: 0x10c, script: 0x5b, flags: 0x0},
+ 365: {region: 0xda, script: 0x5b, flags: 0x0},
+ 366: {region: 0x97, script: 0x5b, flags: 0x0},
+ 367: {region: 0x81, script: 0x5b, flags: 0x0},
+ 368: {region: 0x166, script: 0x5b, flags: 0x0},
+ 369: {region: 0xbd, script: 0x5b, flags: 0x0},
+ 370: {region: 0x166, script: 0x5b, flags: 0x0},
+ 371: {region: 0x166, script: 0x5b, flags: 0x0},
+ 372: {region: 0x166, script: 0x5b, flags: 0x0},
+ 373: {region: 0x53, script: 0x3b, flags: 0x0},
+ 374: {region: 0x166, script: 0x5b, flags: 0x0},
+ 375: {region: 0x96, script: 0x5b, flags: 0x0},
+ 376: {region: 0x166, script: 0x5b, flags: 0x0},
+ 377: {region: 0x166, script: 0x5b, flags: 0x0},
+ 378: {region: 0x9a, script: 0x22, flags: 0x0},
+ 379: {region: 0x166, script: 0x5b, flags: 0x0},
+ 380: {region: 0x9d, script: 0x5, flags: 0x0},
+ 381: {region: 0x7f, script: 0x5b, flags: 0x0},
+ 382: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 383: {region: 0x166, script: 0x5b, flags: 0x0},
+ 384: {region: 0x166, script: 0x5b, flags: 0x0},
+ 385: {region: 0x166, script: 0x5b, flags: 0x0},
+ 386: {region: 0x166, script: 0x5b, flags: 0x0},
+ 387: {region: 0x166, script: 0x5b, flags: 0x0},
+ 388: {region: 0x166, script: 0x5b, flags: 0x0},
+ 389: {region: 0x70, script: 0x2c, flags: 0x0},
+ 390: {region: 0x166, script: 0x5b, flags: 0x0},
+ 391: {region: 0xdc, script: 0x22, flags: 0x0},
+ 392: {region: 0x166, script: 0x5b, flags: 0x0},
+ 393: {region: 0xa8, script: 0x5b, flags: 0x0},
+ 394: {region: 0x166, script: 0x5b, flags: 0x0},
+ 395: {region: 0xe9, script: 0x5, flags: 0x0},
+ 396: {region: 0x166, script: 0x5b, flags: 0x0},
+ 397: {region: 0xe9, script: 0x5, flags: 0x0},
+ 398: {region: 0x166, script: 0x5b, flags: 0x0},
+ 399: {region: 0x166, script: 0x5b, flags: 0x0},
+ 400: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 401: {region: 0x9d, script: 0x5, flags: 0x0},
+ 402: {region: 0x166, script: 0x5b, flags: 0x0},
+ 403: {region: 0x166, script: 0x2c, flags: 0x0},
+ 404: {region: 0xf2, script: 0x5b, flags: 0x0},
+ 405: {region: 0x166, script: 0x5b, flags: 0x0},
+ 406: {region: 0x166, script: 0x5b, flags: 0x0},
+ 407: {region: 0x166, script: 0x5b, flags: 0x0},
+ 408: {region: 0x166, script: 0x2c, flags: 0x0},
+ 409: {region: 0x166, script: 0x5b, flags: 0x0},
+ 410: {region: 0x9a, script: 0x22, flags: 0x0},
+ 411: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 412: {region: 0x96, script: 0x5b, flags: 0x0},
+ 413: {region: 0xda, script: 0x5b, flags: 0x0},
+ 414: {region: 0x131, script: 0x32, flags: 0x0},
+ 415: {region: 0x166, script: 0x5b, flags: 0x0},
+ 416: {region: 0xe, script: 0x2, flags: 0x1},
+ 417: {region: 0x9a, script: 0xe, flags: 0x0},
+ 418: {region: 0x166, script: 0x5b, flags: 0x0},
+ 419: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 420: {region: 0x9a, script: 0x35, flags: 0x0},
+ 421: {region: 0x41, script: 0x5b, flags: 0x0},
+ 422: {region: 0x54, script: 0x5b, flags: 0x0},
+ 423: {region: 0x166, script: 0x5b, flags: 0x0},
+ 424: {region: 0x81, script: 0x5b, flags: 0x0},
+ 425: {region: 0x166, script: 0x5b, flags: 0x0},
+ 426: {region: 0x166, script: 0x5b, flags: 0x0},
+ 427: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 428: {region: 0x99, script: 0x5b, flags: 0x0},
+ 429: {region: 0x166, script: 0x5b, flags: 0x0},
+ 430: {region: 0xdc, script: 0x22, flags: 0x0},
+ 431: {region: 0x166, script: 0x5b, flags: 0x0},
+ 432: {region: 0x166, script: 0x5, flags: 0x0},
+ 433: {region: 0x49, script: 0x5b, flags: 0x0},
+ 434: {region: 0x166, script: 0x5, flags: 0x0},
+ 435: {region: 0x166, script: 0x5b, flags: 0x0},
+ 436: {region: 0x10, script: 0x3, flags: 0x1},
+ 437: {region: 0x166, script: 0x5b, flags: 0x0},
+ 438: {region: 0x53, script: 0x3b, flags: 0x0},
+ 439: {region: 0x166, script: 0x5b, flags: 0x0},
+ 440: {region: 0x136, script: 0x5b, flags: 0x0},
+ 441: {region: 0x24, script: 0x5, flags: 0x0},
+ 442: {region: 0x166, script: 0x5b, flags: 0x0},
+ 443: {region: 0x166, script: 0x2c, flags: 0x0},
+ 444: {region: 0x98, script: 0x3e, flags: 0x0},
+ 445: {region: 0x166, script: 0x5b, flags: 0x0},
+ 446: {region: 0x9a, script: 0x22, flags: 0x0},
+ 447: {region: 0x166, script: 0x5b, flags: 0x0},
+ 448: {region: 0x74, script: 0x5b, flags: 0x0},
+ 449: {region: 0x166, script: 0x5b, flags: 0x0},
+ 450: {region: 0x166, script: 0x5b, flags: 0x0},
+ 451: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 452: {region: 0x166, script: 0x5b, flags: 0x0},
+ 453: {region: 0x12c, script: 0x40, flags: 0x0},
+ 454: {region: 0x53, script: 0x92, flags: 0x0},
+ 455: {region: 0x166, script: 0x5b, flags: 0x0},
+ 456: {region: 0xe9, script: 0x5, flags: 0x0},
+ 457: {region: 0x9a, script: 0x22, flags: 0x0},
+ 458: {region: 0xb0, script: 0x41, flags: 0x0},
+ 459: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 460: {region: 0xe9, script: 0x5, flags: 0x0},
+ 461: {region: 0xe7, script: 0x5b, flags: 0x0},
+ 462: {region: 0x9a, script: 0x22, flags: 0x0},
+ 463: {region: 0x9a, script: 0x22, flags: 0x0},
+ 464: {region: 0x166, script: 0x5b, flags: 0x0},
+ 465: {region: 0x91, script: 0x5b, flags: 0x0},
+ 466: {region: 0x61, script: 0x5b, flags: 0x0},
+ 467: {region: 0x53, script: 0x3b, flags: 0x0},
+ 468: {region: 0x92, script: 0x5b, flags: 0x0},
+ 469: {region: 0x93, script: 0x5b, flags: 0x0},
+ 470: {region: 0x166, script: 0x5b, flags: 0x0},
+ 471: {region: 0x28, script: 0x8, flags: 0x0},
+ 472: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 473: {region: 0x79, script: 0x5b, flags: 0x0},
+ 474: {region: 0x166, script: 0x5b, flags: 0x0},
+ 475: {region: 0x166, script: 0x5b, flags: 0x0},
+ 476: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 477: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 478: {region: 0x166, script: 0x5b, flags: 0x0},
+ 479: {region: 0x166, script: 0x5b, flags: 0x0},
+ 480: {region: 0x166, script: 0x5b, flags: 0x0},
+ 481: {region: 0x96, script: 0x5b, flags: 0x0},
+ 482: {region: 0x166, script: 0x5b, flags: 0x0},
+ 483: {region: 0x166, script: 0x5b, flags: 0x0},
+ 484: {region: 0x166, script: 0x5b, flags: 0x0},
+ 486: {region: 0x123, script: 0x5b, flags: 0x0},
+ 487: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 488: {region: 0x166, script: 0x5b, flags: 0x0},
+ 489: {region: 0x166, script: 0x5b, flags: 0x0},
+ 490: {region: 0x53, script: 0xfd, flags: 0x0},
+ 491: {region: 0x166, script: 0x5b, flags: 0x0},
+ 492: {region: 0x136, script: 0x5b, flags: 0x0},
+ 493: {region: 0x166, script: 0x5b, flags: 0x0},
+ 494: {region: 0x49, script: 0x5b, flags: 0x0},
+ 495: {region: 0x166, script: 0x5b, flags: 0x0},
+ 496: {region: 0x166, script: 0x5b, flags: 0x0},
+ 497: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 498: {region: 0x166, script: 0x5b, flags: 0x0},
+ 499: {region: 0x96, script: 0x5b, flags: 0x0},
+ 500: {region: 0x107, script: 0x20, flags: 0x0},
+ 501: {region: 0x1, script: 0x5b, flags: 0x0},
+ 502: {region: 0x166, script: 0x5b, flags: 0x0},
+ 503: {region: 0x166, script: 0x5b, flags: 0x0},
+ 504: {region: 0x9e, script: 0x5b, flags: 0x0},
+ 505: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 506: {region: 0x49, script: 0x17, flags: 0x0},
+ 507: {region: 0x98, script: 0x3e, flags: 0x0},
+ 508: {region: 0x166, script: 0x5b, flags: 0x0},
+ 509: {region: 0x166, script: 0x5b, flags: 0x0},
+ 510: {region: 0x107, script: 0x5b, flags: 0x0},
+ 511: {region: 0x166, script: 0x5b, flags: 0x0},
+ 512: {region: 0xa3, script: 0x49, flags: 0x0},
+ 513: {region: 0x166, script: 0x5b, flags: 0x0},
+ 514: {region: 0xa1, script: 0x5b, flags: 0x0},
+ 515: {region: 0x1, script: 0x5b, flags: 0x0},
+ 516: {region: 0x166, script: 0x5b, flags: 0x0},
+ 517: {region: 0x166, script: 0x5b, flags: 0x0},
+ 518: {region: 0x166, script: 0x5b, flags: 0x0},
+ 519: {region: 0x52, script: 0x5b, flags: 0x0},
+ 520: {region: 0x131, script: 0x3e, flags: 0x0},
+ 521: {region: 0x166, script: 0x5b, flags: 0x0},
+ 522: {region: 0x130, script: 0x5b, flags: 0x0},
+ 523: {region: 0xdc, script: 0x22, flags: 0x0},
+ 524: {region: 0x166, script: 0x5b, flags: 0x0},
+ 525: {region: 0x64, script: 0x5b, flags: 0x0},
+ 526: {region: 0x96, script: 0x5b, flags: 0x0},
+ 527: {region: 0x96, script: 0x5b, flags: 0x0},
+ 528: {region: 0x7e, script: 0x2e, flags: 0x0},
+ 529: {region: 0x138, script: 0x20, flags: 0x0},
+ 530: {region: 0x68, script: 0x5b, flags: 0x0},
+ 531: {region: 0xc5, script: 0x5b, flags: 0x0},
+ 532: {region: 0x166, script: 0x5b, flags: 0x0},
+ 533: {region: 0x166, script: 0x5b, flags: 0x0},
+ 534: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 535: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 536: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 537: {region: 0x107, script: 0x20, flags: 0x0},
+ 538: {region: 0x166, script: 0x5b, flags: 0x0},
+ 539: {region: 0x166, script: 0x5b, flags: 0x0},
+ 540: {region: 0x166, script: 0x5b, flags: 0x0},
+ 541: {region: 0x166, script: 0x5b, flags: 0x0},
+ 542: {region: 0xd5, script: 0x5, flags: 0x0},
+ 543: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 544: {region: 0x165, script: 0x5b, flags: 0x0},
+ 545: {region: 0x166, script: 0x5b, flags: 0x0},
+ 546: {region: 0x166, script: 0x5b, flags: 0x0},
+ 547: {region: 0x130, script: 0x5b, flags: 0x0},
+ 548: {region: 0x123, script: 0x5, flags: 0x0},
+ 549: {region: 0x166, script: 0x5b, flags: 0x0},
+ 550: {region: 0x124, script: 0xee, flags: 0x0},
+ 551: {region: 0x5b, script: 0x5b, flags: 0x0},
+ 552: {region: 0x52, script: 0x5b, flags: 0x0},
+ 553: {region: 0x166, script: 0x5b, flags: 0x0},
+ 554: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 555: {region: 0x9a, script: 0x22, flags: 0x0},
+ 556: {region: 0x9a, script: 0x22, flags: 0x0},
+ 557: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 558: {region: 0x96, script: 0x5b, flags: 0x0},
+ 559: {region: 0x166, script: 0x5b, flags: 0x0},
+ 560: {region: 0x41, script: 0x5b, flags: 0x0},
+ 561: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 562: {region: 0x53, script: 0xe5, flags: 0x0},
+ 563: {region: 0x9a, script: 0x22, flags: 0x0},
+ 564: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 565: {region: 0x166, script: 0x5b, flags: 0x0},
+ 566: {region: 0x9a, script: 0x76, flags: 0x0},
+ 567: {region: 0xe9, script: 0x5, flags: 0x0},
+ 568: {region: 0x166, script: 0x5b, flags: 0x0},
+ 569: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 570: {region: 0x166, script: 0x5b, flags: 0x0},
+ 571: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 572: {region: 0x166, script: 0x5b, flags: 0x0},
+ 573: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 574: {region: 0x166, script: 0x5b, flags: 0x0},
+ 575: {region: 0xb0, script: 0x58, flags: 0x0},
+ 576: {region: 0x166, script: 0x5b, flags: 0x0},
+ 577: {region: 0x166, script: 0x5b, flags: 0x0},
+ 578: {region: 0x13, script: 0x6, flags: 0x1},
+ 579: {region: 0x166, script: 0x5b, flags: 0x0},
+ 580: {region: 0x52, script: 0x5b, flags: 0x0},
+ 581: {region: 0x83, script: 0x5b, flags: 0x0},
+ 582: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 583: {region: 0x166, script: 0x5b, flags: 0x0},
+ 584: {region: 0x166, script: 0x5b, flags: 0x0},
+ 585: {region: 0x166, script: 0x5b, flags: 0x0},
+ 586: {region: 0xa7, script: 0x4f, flags: 0x0},
+ 587: {region: 0x2a, script: 0x5b, flags: 0x0},
+ 588: {region: 0x166, script: 0x5b, flags: 0x0},
+ 589: {region: 0x166, script: 0x5b, flags: 0x0},
+ 590: {region: 0x166, script: 0x5b, flags: 0x0},
+ 591: {region: 0x166, script: 0x5b, flags: 0x0},
+ 592: {region: 0x166, script: 0x5b, flags: 0x0},
+ 593: {region: 0x9a, script: 0x53, flags: 0x0},
+ 594: {region: 0x8c, script: 0x5b, flags: 0x0},
+ 595: {region: 0x166, script: 0x5b, flags: 0x0},
+ 596: {region: 0xac, script: 0x54, flags: 0x0},
+ 597: {region: 0x107, script: 0x20, flags: 0x0},
+ 598: {region: 0x9a, script: 0x22, flags: 0x0},
+ 599: {region: 0x166, script: 0x5b, flags: 0x0},
+ 600: {region: 0x76, script: 0x5b, flags: 0x0},
+ 601: {region: 0x166, script: 0x5b, flags: 0x0},
+ 602: {region: 0xb5, script: 0x5b, flags: 0x0},
+ 603: {region: 0x166, script: 0x5b, flags: 0x0},
+ 604: {region: 0x166, script: 0x5b, flags: 0x0},
+ 605: {region: 0x166, script: 0x5b, flags: 0x0},
+ 606: {region: 0x166, script: 0x5b, flags: 0x0},
+ 607: {region: 0x166, script: 0x5b, flags: 0x0},
+ 608: {region: 0x166, script: 0x5b, flags: 0x0},
+ 609: {region: 0x166, script: 0x5b, flags: 0x0},
+ 610: {region: 0x166, script: 0x2c, flags: 0x0},
+ 611: {region: 0x166, script: 0x5b, flags: 0x0},
+ 612: {region: 0x107, script: 0x20, flags: 0x0},
+ 613: {region: 0x113, script: 0x5b, flags: 0x0},
+ 614: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 615: {region: 0x107, script: 0x5b, flags: 0x0},
+ 616: {region: 0x166, script: 0x5b, flags: 0x0},
+ 617: {region: 0x9a, script: 0x22, flags: 0x0},
+ 618: {region: 0x9a, script: 0x5, flags: 0x0},
+ 619: {region: 0x130, script: 0x5b, flags: 0x0},
+ 620: {region: 0x166, script: 0x5b, flags: 0x0},
+ 621: {region: 0x52, script: 0x5b, flags: 0x0},
+ 622: {region: 0x61, script: 0x5b, flags: 0x0},
+ 623: {region: 0x166, script: 0x5b, flags: 0x0},
+ 624: {region: 0x166, script: 0x5b, flags: 0x0},
+ 625: {region: 0x166, script: 0x2c, flags: 0x0},
+ 626: {region: 0x166, script: 0x5b, flags: 0x0},
+ 627: {region: 0x166, script: 0x5b, flags: 0x0},
+ 628: {region: 0x19, script: 0x3, flags: 0x1},
+ 629: {region: 0x166, script: 0x5b, flags: 0x0},
+ 630: {region: 0x166, script: 0x5b, flags: 0x0},
+ 631: {region: 0x166, script: 0x5b, flags: 0x0},
+ 632: {region: 0x166, script: 0x5b, flags: 0x0},
+ 633: {region: 0x107, script: 0x20, flags: 0x0},
+ 634: {region: 0x166, script: 0x5b, flags: 0x0},
+ 635: {region: 0x166, script: 0x5b, flags: 0x0},
+ 636: {region: 0x166, script: 0x5b, flags: 0x0},
+ 637: {region: 0x107, script: 0x20, flags: 0x0},
+ 638: {region: 0x166, script: 0x5b, flags: 0x0},
+ 639: {region: 0x96, script: 0x5b, flags: 0x0},
+ 640: {region: 0xe9, script: 0x5, flags: 0x0},
+ 641: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 642: {region: 0x166, script: 0x5b, flags: 0x0},
+ 643: {region: 0x166, script: 0x5b, flags: 0x0},
+ 644: {region: 0x166, script: 0x5b, flags: 0x0},
+ 645: {region: 0x166, script: 0x2c, flags: 0x0},
+ 646: {region: 0x124, script: 0xee, flags: 0x0},
+ 647: {region: 0xe9, script: 0x5, flags: 0x0},
+ 648: {region: 0x166, script: 0x5b, flags: 0x0},
+ 649: {region: 0x166, script: 0x5b, flags: 0x0},
+ 650: {region: 0x1c, script: 0x5, flags: 0x1},
+ 651: {region: 0x166, script: 0x5b, flags: 0x0},
+ 652: {region: 0x166, script: 0x5b, flags: 0x0},
+ 653: {region: 0x166, script: 0x5b, flags: 0x0},
+ 654: {region: 0x139, script: 0x5b, flags: 0x0},
+ 655: {region: 0x88, script: 0x5f, flags: 0x0},
+ 656: {region: 0x98, script: 0x3e, flags: 0x0},
+ 657: {region: 0x130, script: 0x5b, flags: 0x0},
+ 658: {region: 0xe9, script: 0x5, flags: 0x0},
+ 659: {region: 0x132, script: 0x5b, flags: 0x0},
+ 660: {region: 0x166, script: 0x5b, flags: 0x0},
+ 661: {region: 0xb8, script: 0x5b, flags: 0x0},
+ 662: {region: 0x107, script: 0x20, flags: 0x0},
+ 663: {region: 0x166, script: 0x5b, flags: 0x0},
+ 664: {region: 0x96, script: 0x5b, flags: 0x0},
+ 665: {region: 0x166, script: 0x5b, flags: 0x0},
+ 666: {region: 0x53, script: 0xee, flags: 0x0},
+ 667: {region: 0x166, script: 0x5b, flags: 0x0},
+ 668: {region: 0x166, script: 0x5b, flags: 0x0},
+ 669: {region: 0x166, script: 0x5b, flags: 0x0},
+ 670: {region: 0x166, script: 0x5b, flags: 0x0},
+ 671: {region: 0x9a, script: 0x5d, flags: 0x0},
+ 672: {region: 0x166, script: 0x5b, flags: 0x0},
+ 673: {region: 0x166, script: 0x5b, flags: 0x0},
+ 674: {region: 0x107, script: 0x20, flags: 0x0},
+ 675: {region: 0x132, script: 0x5b, flags: 0x0},
+ 676: {region: 0x166, script: 0x5b, flags: 0x0},
+ 677: {region: 0xda, script: 0x5b, flags: 0x0},
+ 678: {region: 0x166, script: 0x5b, flags: 0x0},
+ 679: {region: 0x166, script: 0x5b, flags: 0x0},
+ 680: {region: 0x21, script: 0x2, flags: 0x1},
+ 681: {region: 0x166, script: 0x5b, flags: 0x0},
+ 682: {region: 0x166, script: 0x5b, flags: 0x0},
+ 683: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 684: {region: 0x53, script: 0x61, flags: 0x0},
+ 685: {region: 0x96, script: 0x5b, flags: 0x0},
+ 686: {region: 0x9d, script: 0x5, flags: 0x0},
+ 687: {region: 0x136, script: 0x5b, flags: 0x0},
+ 688: {region: 0x166, script: 0x5b, flags: 0x0},
+ 689: {region: 0x166, script: 0x5b, flags: 0x0},
+ 690: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 691: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 692: {region: 0x166, script: 0x5b, flags: 0x0},
+ 693: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 694: {region: 0x166, script: 0x5b, flags: 0x0},
+ 695: {region: 0x166, script: 0x5b, flags: 0x0},
+ 696: {region: 0xb0, script: 0x58, flags: 0x0},
+ 697: {region: 0x166, script: 0x5b, flags: 0x0},
+ 698: {region: 0x166, script: 0x5b, flags: 0x0},
+ 699: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 700: {region: 0x166, script: 0x5b, flags: 0x0},
+ 701: {region: 0x166, script: 0x5b, flags: 0x0},
+ 702: {region: 0x163, script: 0x5b, flags: 0x0},
+ 703: {region: 0x9d, script: 0x5, flags: 0x0},
+ 704: {region: 0xb7, script: 0x5b, flags: 0x0},
+ 705: {region: 0xb9, script: 0x5b, flags: 0x0},
+ 706: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 707: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 708: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 709: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 710: {region: 0x9d, script: 0x5, flags: 0x0},
+ 711: {region: 0xb9, script: 0x5b, flags: 0x0},
+ 712: {region: 0x124, script: 0xee, flags: 0x0},
+ 713: {region: 0x53, script: 0x3b, flags: 0x0},
+ 714: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 715: {region: 0x96, script: 0x5b, flags: 0x0},
+ 716: {region: 0x52, script: 0x5b, flags: 0x0},
+ 717: {region: 0x9a, script: 0x22, flags: 0x0},
+ 718: {region: 0x9a, script: 0x22, flags: 0x0},
+ 719: {region: 0x96, script: 0x5b, flags: 0x0},
+ 720: {region: 0x23, script: 0x3, flags: 0x1},
+ 721: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 722: {region: 0x166, script: 0x5b, flags: 0x0},
+ 723: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 724: {region: 0x166, script: 0x5b, flags: 0x0},
+ 725: {region: 0x166, script: 0x5b, flags: 0x0},
+ 726: {region: 0x166, script: 0x5b, flags: 0x0},
+ 727: {region: 0x166, script: 0x5b, flags: 0x0},
+ 728: {region: 0x166, script: 0x5b, flags: 0x0},
+ 729: {region: 0x166, script: 0x5b, flags: 0x0},
+ 730: {region: 0x166, script: 0x5b, flags: 0x0},
+ 731: {region: 0x166, script: 0x5b, flags: 0x0},
+ 732: {region: 0x166, script: 0x5b, flags: 0x0},
+ 733: {region: 0x166, script: 0x5b, flags: 0x0},
+ 734: {region: 0x166, script: 0x5b, flags: 0x0},
+ 735: {region: 0x166, script: 0x5, flags: 0x0},
+ 736: {region: 0x107, script: 0x20, flags: 0x0},
+ 737: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 738: {region: 0x166, script: 0x5b, flags: 0x0},
+ 739: {region: 0x96, script: 0x5b, flags: 0x0},
+ 740: {region: 0x166, script: 0x2c, flags: 0x0},
+ 741: {region: 0x166, script: 0x5b, flags: 0x0},
+ 742: {region: 0x166, script: 0x5b, flags: 0x0},
+ 743: {region: 0x166, script: 0x5b, flags: 0x0},
+ 744: {region: 0x113, script: 0x5b, flags: 0x0},
+ 745: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 746: {region: 0x166, script: 0x5b, flags: 0x0},
+ 747: {region: 0x166, script: 0x5b, flags: 0x0},
+ 748: {region: 0x124, script: 0x5, flags: 0x0},
+ 749: {region: 0xcd, script: 0x5b, flags: 0x0},
+ 750: {region: 0x166, script: 0x5b, flags: 0x0},
+ 751: {region: 0x166, script: 0x5b, flags: 0x0},
+ 752: {region: 0x166, script: 0x5b, flags: 0x0},
+ 753: {region: 0xc0, script: 0x5b, flags: 0x0},
+ 754: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 755: {region: 0x166, script: 0x5b, flags: 0x0},
+ 756: {region: 0x52, script: 0x5b, flags: 0x0},
+ 757: {region: 0xdc, script: 0x22, flags: 0x0},
+ 758: {region: 0x130, script: 0x5b, flags: 0x0},
+ 759: {region: 0xc1, script: 0x5b, flags: 0x0},
+ 760: {region: 0x166, script: 0x5b, flags: 0x0},
+ 761: {region: 0x166, script: 0x5b, flags: 0x0},
+ 762: {region: 0xe1, script: 0x5b, flags: 0x0},
+ 763: {region: 0x166, script: 0x5b, flags: 0x0},
+ 764: {region: 0x96, script: 0x5b, flags: 0x0},
+ 765: {region: 0x9c, script: 0x3d, flags: 0x0},
+ 766: {region: 0x166, script: 0x5b, flags: 0x0},
+ 767: {region: 0xc3, script: 0x20, flags: 0x0},
+ 768: {region: 0x166, script: 0x5, flags: 0x0},
+ 769: {region: 0x166, script: 0x5b, flags: 0x0},
+ 770: {region: 0x166, script: 0x5b, flags: 0x0},
+ 771: {region: 0x166, script: 0x5b, flags: 0x0},
+ 772: {region: 0x9a, script: 0x6f, flags: 0x0},
+ 773: {region: 0x166, script: 0x5b, flags: 0x0},
+ 774: {region: 0x166, script: 0x5b, flags: 0x0},
+ 775: {region: 0x10c, script: 0x5b, flags: 0x0},
+ 776: {region: 0x166, script: 0x5b, flags: 0x0},
+ 777: {region: 0x166, script: 0x5b, flags: 0x0},
+ 778: {region: 0x166, script: 0x5b, flags: 0x0},
+ 779: {region: 0x26, script: 0x3, flags: 0x1},
+ 780: {region: 0x166, script: 0x5b, flags: 0x0},
+ 781: {region: 0x166, script: 0x5b, flags: 0x0},
+ 782: {region: 0x9a, script: 0xe, flags: 0x0},
+ 783: {region: 0xc5, script: 0x76, flags: 0x0},
+ 785: {region: 0x166, script: 0x5b, flags: 0x0},
+ 786: {region: 0x49, script: 0x5b, flags: 0x0},
+ 787: {region: 0x49, script: 0x5b, flags: 0x0},
+ 788: {region: 0x37, script: 0x5b, flags: 0x0},
+ 789: {region: 0x166, script: 0x5b, flags: 0x0},
+ 790: {region: 0x166, script: 0x5b, flags: 0x0},
+ 791: {region: 0x166, script: 0x5b, flags: 0x0},
+ 792: {region: 0x166, script: 0x5b, flags: 0x0},
+ 793: {region: 0x166, script: 0x5b, flags: 0x0},
+ 794: {region: 0x166, script: 0x5b, flags: 0x0},
+ 795: {region: 0x9a, script: 0x22, flags: 0x0},
+ 796: {region: 0xdc, script: 0x22, flags: 0x0},
+ 797: {region: 0x107, script: 0x20, flags: 0x0},
+ 798: {region: 0x35, script: 0x73, flags: 0x0},
+ 799: {region: 0x29, script: 0x3, flags: 0x1},
+ 800: {region: 0xcc, script: 0x5b, flags: 0x0},
+ 801: {region: 0x166, script: 0x5b, flags: 0x0},
+ 802: {region: 0x166, script: 0x5b, flags: 0x0},
+ 803: {region: 0x166, script: 0x5b, flags: 0x0},
+ 804: {region: 0x9a, script: 0x22, flags: 0x0},
+ 805: {region: 0x52, script: 0x5b, flags: 0x0},
+ 807: {region: 0x166, script: 0x5b, flags: 0x0},
+ 808: {region: 0x136, script: 0x5b, flags: 0x0},
+ 809: {region: 0x166, script: 0x5b, flags: 0x0},
+ 810: {region: 0x166, script: 0x5b, flags: 0x0},
+ 811: {region: 0xe9, script: 0x5, flags: 0x0},
+ 812: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 813: {region: 0x9a, script: 0x22, flags: 0x0},
+ 814: {region: 0x96, script: 0x5b, flags: 0x0},
+ 815: {region: 0x165, script: 0x5b, flags: 0x0},
+ 816: {region: 0x166, script: 0x5b, flags: 0x0},
+ 817: {region: 0xc5, script: 0x76, flags: 0x0},
+ 818: {region: 0x166, script: 0x5b, flags: 0x0},
+ 819: {region: 0x166, script: 0x2c, flags: 0x0},
+ 820: {region: 0x107, script: 0x20, flags: 0x0},
+ 821: {region: 0x166, script: 0x5b, flags: 0x0},
+ 822: {region: 0x132, script: 0x5b, flags: 0x0},
+ 823: {region: 0x9d, script: 0x67, flags: 0x0},
+ 824: {region: 0x166, script: 0x5b, flags: 0x0},
+ 825: {region: 0x166, script: 0x5b, flags: 0x0},
+ 826: {region: 0x9d, script: 0x5, flags: 0x0},
+ 827: {region: 0x166, script: 0x5b, flags: 0x0},
+ 828: {region: 0x166, script: 0x5b, flags: 0x0},
+ 829: {region: 0x166, script: 0x5b, flags: 0x0},
+ 830: {region: 0xde, script: 0x5b, flags: 0x0},
+ 831: {region: 0x166, script: 0x5b, flags: 0x0},
+ 832: {region: 0x166, script: 0x5b, flags: 0x0},
+ 834: {region: 0x166, script: 0x5b, flags: 0x0},
+ 835: {region: 0x53, script: 0x3b, flags: 0x0},
+ 836: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 837: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 838: {region: 0x166, script: 0x5b, flags: 0x0},
+ 839: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 840: {region: 0x166, script: 0x5b, flags: 0x0},
+ 841: {region: 0x166, script: 0x5b, flags: 0x0},
+ 842: {region: 0x166, script: 0x5b, flags: 0x0},
+ 843: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 844: {region: 0x166, script: 0x5b, flags: 0x0},
+ 845: {region: 0x166, script: 0x5b, flags: 0x0},
+ 846: {region: 0x165, script: 0x5b, flags: 0x0},
+ 847: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 848: {region: 0x61, script: 0x5b, flags: 0x0},
+ 849: {region: 0xdc, script: 0x22, flags: 0x0},
+ 850: {region: 0x166, script: 0x5b, flags: 0x0},
+ 851: {region: 0xdc, script: 0x22, flags: 0x0},
+ 852: {region: 0x166, script: 0x5b, flags: 0x0},
+ 853: {region: 0x166, script: 0x5b, flags: 0x0},
+ 854: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 855: {region: 0x166, script: 0x5b, flags: 0x0},
+ 856: {region: 0x166, script: 0x5b, flags: 0x0},
+ 857: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 858: {region: 0x166, script: 0x5b, flags: 0x0},
+ 859: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 860: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 861: {region: 0x166, script: 0x5b, flags: 0x0},
+ 862: {region: 0x166, script: 0x5b, flags: 0x0},
+ 863: {region: 0x96, script: 0x5b, flags: 0x0},
+ 864: {region: 0x166, script: 0x5b, flags: 0x0},
+ 865: {region: 0xe0, script: 0x5b, flags: 0x0},
+ 866: {region: 0x166, script: 0x5b, flags: 0x0},
+ 867: {region: 0x166, script: 0x5b, flags: 0x0},
+ 868: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 869: {region: 0x166, script: 0x5b, flags: 0x0},
+ 870: {region: 0x166, script: 0x5b, flags: 0x0},
+ 871: {region: 0xda, script: 0x5b, flags: 0x0},
+ 872: {region: 0x52, script: 0x5b, flags: 0x0},
+ 873: {region: 0x166, script: 0x5b, flags: 0x0},
+ 874: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 875: {region: 0x166, script: 0x5b, flags: 0x0},
+ 876: {region: 0x52, script: 0x5b, flags: 0x0},
+ 877: {region: 0x166, script: 0x5b, flags: 0x0},
+ 878: {region: 0x166, script: 0x5b, flags: 0x0},
+ 879: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 880: {region: 0x124, script: 0x57, flags: 0x0},
+ 881: {region: 0x9a, script: 0x22, flags: 0x0},
+ 882: {region: 0x10d, script: 0xcb, flags: 0x0},
+ 883: {region: 0x166, script: 0x5b, flags: 0x0},
+ 884: {region: 0x166, script: 0x5b, flags: 0x0},
+ 885: {region: 0x85, script: 0x7e, flags: 0x0},
+ 886: {region: 0x162, script: 0x5b, flags: 0x0},
+ 887: {region: 0x166, script: 0x5b, flags: 0x0},
+ 888: {region: 0x49, script: 0x17, flags: 0x0},
+ 889: {region: 0x166, script: 0x5b, flags: 0x0},
+ 890: {region: 0x162, script: 0x5b, flags: 0x0},
+ 891: {region: 0x166, script: 0x5b, flags: 0x0},
+ 892: {region: 0x166, script: 0x5b, flags: 0x0},
+ 893: {region: 0x166, script: 0x5b, flags: 0x0},
+ 894: {region: 0x166, script: 0x5b, flags: 0x0},
+ 895: {region: 0x166, script: 0x5b, flags: 0x0},
+ 896: {region: 0x118, script: 0x5b, flags: 0x0},
+ 897: {region: 0x166, script: 0x5b, flags: 0x0},
+ 898: {region: 0x166, script: 0x5b, flags: 0x0},
+ 899: {region: 0x136, script: 0x5b, flags: 0x0},
+ 900: {region: 0x166, script: 0x5b, flags: 0x0},
+ 901: {region: 0x53, script: 0x5b, flags: 0x0},
+ 902: {region: 0x166, script: 0x5b, flags: 0x0},
+ 903: {region: 0xcf, script: 0x5b, flags: 0x0},
+ 904: {region: 0x130, script: 0x5b, flags: 0x0},
+ 905: {region: 0x132, script: 0x5b, flags: 0x0},
+ 906: {region: 0x81, script: 0x5b, flags: 0x0},
+ 907: {region: 0x79, script: 0x5b, flags: 0x0},
+ 908: {region: 0x166, script: 0x5b, flags: 0x0},
+ 910: {region: 0x166, script: 0x5b, flags: 0x0},
+ 911: {region: 0x166, script: 0x5b, flags: 0x0},
+ 912: {region: 0x70, script: 0x5b, flags: 0x0},
+ 913: {region: 0x166, script: 0x5b, flags: 0x0},
+ 914: {region: 0x166, script: 0x5b, flags: 0x0},
+ 915: {region: 0x166, script: 0x5b, flags: 0x0},
+ 916: {region: 0x166, script: 0x5b, flags: 0x0},
+ 917: {region: 0x9a, script: 0x83, flags: 0x0},
+ 918: {region: 0x166, script: 0x5b, flags: 0x0},
+ 919: {region: 0x166, script: 0x5, flags: 0x0},
+ 920: {region: 0x7e, script: 0x20, flags: 0x0},
+ 921: {region: 0x136, script: 0x84, flags: 0x0},
+ 922: {region: 0x166, script: 0x5, flags: 0x0},
+ 923: {region: 0xc6, script: 0x82, flags: 0x0},
+ 924: {region: 0x166, script: 0x5b, flags: 0x0},
+ 925: {region: 0x2c, script: 0x3, flags: 0x1},
+ 926: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 927: {region: 0x2f, script: 0x2, flags: 0x1},
+ 928: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 929: {region: 0x30, script: 0x5b, flags: 0x0},
+ 930: {region: 0xf1, script: 0x5b, flags: 0x0},
+ 931: {region: 0x166, script: 0x5b, flags: 0x0},
+ 932: {region: 0x79, script: 0x5b, flags: 0x0},
+ 933: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 934: {region: 0x136, script: 0x5b, flags: 0x0},
+ 935: {region: 0x49, script: 0x5b, flags: 0x0},
+ 936: {region: 0x166, script: 0x5b, flags: 0x0},
+ 937: {region: 0x9d, script: 0xfa, flags: 0x0},
+ 938: {region: 0x166, script: 0x5b, flags: 0x0},
+ 939: {region: 0x61, script: 0x5b, flags: 0x0},
+ 940: {region: 0x166, script: 0x5, flags: 0x0},
+ 941: {region: 0xb1, script: 0x90, flags: 0x0},
+ 943: {region: 0x166, script: 0x5b, flags: 0x0},
+ 944: {region: 0x166, script: 0x5b, flags: 0x0},
+ 945: {region: 0x9a, script: 0x12, flags: 0x0},
+ 946: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 947: {region: 0xea, script: 0x5b, flags: 0x0},
+ 948: {region: 0x166, script: 0x5b, flags: 0x0},
+ 949: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 950: {region: 0x166, script: 0x5b, flags: 0x0},
+ 951: {region: 0x166, script: 0x5b, flags: 0x0},
+ 952: {region: 0x88, script: 0x34, flags: 0x0},
+ 953: {region: 0x76, script: 0x5b, flags: 0x0},
+ 954: {region: 0x166, script: 0x5b, flags: 0x0},
+ 955: {region: 0xe9, script: 0x4e, flags: 0x0},
+ 956: {region: 0x9d, script: 0x5, flags: 0x0},
+ 957: {region: 0x1, script: 0x5b, flags: 0x0},
+ 958: {region: 0x24, script: 0x5, flags: 0x0},
+ 959: {region: 0x166, script: 0x5b, flags: 0x0},
+ 960: {region: 0x41, script: 0x5b, flags: 0x0},
+ 961: {region: 0x166, script: 0x5b, flags: 0x0},
+ 962: {region: 0x7b, script: 0x5b, flags: 0x0},
+ 963: {region: 0x166, script: 0x5b, flags: 0x0},
+ 964: {region: 0xe5, script: 0x5b, flags: 0x0},
+ 965: {region: 0x8a, script: 0x5b, flags: 0x0},
+ 966: {region: 0x6a, script: 0x5b, flags: 0x0},
+ 967: {region: 0x166, script: 0x5b, flags: 0x0},
+ 968: {region: 0x9a, script: 0x22, flags: 0x0},
+ 969: {region: 0x166, script: 0x5b, flags: 0x0},
+ 970: {region: 0x103, script: 0x5b, flags: 0x0},
+ 971: {region: 0x96, script: 0x5b, flags: 0x0},
+ 972: {region: 0x166, script: 0x5b, flags: 0x0},
+ 973: {region: 0x166, script: 0x5b, flags: 0x0},
+ 974: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 975: {region: 0x166, script: 0x5, flags: 0x0},
+ 976: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 977: {region: 0x31, script: 0x2, flags: 0x1},
+ 978: {region: 0xdc, script: 0x22, flags: 0x0},
+ 979: {region: 0x35, script: 0xe, flags: 0x0},
+ 980: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 981: {region: 0x73, script: 0x5b, flags: 0x0},
+ 982: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 983: {region: 0x9d, script: 0x5, flags: 0x0},
+ 984: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 985: {region: 0x3a, script: 0x5b, flags: 0x0},
+ 986: {region: 0x166, script: 0x5b, flags: 0x0},
+ 987: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 988: {region: 0x105, script: 0x5b, flags: 0x0},
+ 989: {region: 0x96, script: 0x5b, flags: 0x0},
+ 990: {region: 0x130, script: 0x5b, flags: 0x0},
+ 991: {region: 0x166, script: 0x5b, flags: 0x0},
+ 992: {region: 0x166, script: 0x5b, flags: 0x0},
+ 993: {region: 0x74, script: 0x5b, flags: 0x0},
+ 994: {region: 0x107, script: 0x20, flags: 0x0},
+ 995: {region: 0x131, script: 0x20, flags: 0x0},
+ 996: {region: 0x10a, script: 0x5b, flags: 0x0},
+ 997: {region: 0x108, script: 0x5b, flags: 0x0},
+ 998: {region: 0x130, script: 0x5b, flags: 0x0},
+ 999: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1000: {region: 0xa3, script: 0x4c, flags: 0x0},
+ 1001: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1002: {region: 0x81, script: 0x5b, flags: 0x0},
+ 1003: {region: 0x107, script: 0x20, flags: 0x0},
+ 1004: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 1005: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1006: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 1007: {region: 0x115, script: 0x5b, flags: 0x0},
+ 1008: {region: 0x9a, script: 0xcf, flags: 0x0},
+ 1009: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1010: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1011: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1012: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1013: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1014: {region: 0x166, script: 0x5, flags: 0x0},
+ 1015: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1016: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 1017: {region: 0x49, script: 0x5b, flags: 0x0},
+ 1018: {region: 0x33, script: 0x4, flags: 0x1},
+ 1019: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1020: {region: 0x9d, script: 0x5, flags: 0x0},
+ 1021: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 1022: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 1023: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 1024: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 1025: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 1026: {region: 0x4c, script: 0x5b, flags: 0x0},
+ 1027: {region: 0x97, script: 0x80, flags: 0x0},
+ 1028: {region: 0xb7, script: 0x5b, flags: 0x0},
+ 1029: {region: 0x166, script: 0x2c, flags: 0x0},
+ 1030: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1032: {region: 0xbb, script: 0xeb, flags: 0x0},
+ 1033: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1034: {region: 0xc5, script: 0x76, flags: 0x0},
+ 1035: {region: 0x166, script: 0x5, flags: 0x0},
+ 1036: {region: 0xb4, script: 0xd6, flags: 0x0},
+ 1037: {region: 0x70, script: 0x5b, flags: 0x0},
+ 1038: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1039: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1040: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1041: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1042: {region: 0x112, script: 0x5b, flags: 0x0},
+ 1043: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1044: {region: 0xe9, script: 0x5, flags: 0x0},
+ 1045: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1046: {region: 0x110, script: 0x5b, flags: 0x0},
+ 1047: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1048: {region: 0xea, script: 0x5b, flags: 0x0},
+ 1049: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1050: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1051: {region: 0x143, script: 0x5b, flags: 0x0},
+ 1052: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 1054: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 1055: {region: 0x73, script: 0x5b, flags: 0x0},
+ 1056: {region: 0x98, script: 0xcc, flags: 0x0},
+ 1057: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1058: {region: 0x73, script: 0x5b, flags: 0x0},
+ 1059: {region: 0x165, script: 0x5b, flags: 0x0},
+ 1060: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1061: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 1062: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1063: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1064: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1065: {region: 0x116, script: 0x5b, flags: 0x0},
+ 1066: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1067: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1068: {region: 0x124, script: 0xee, flags: 0x0},
+ 1069: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1070: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1071: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1072: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1073: {region: 0x27, script: 0x5b, flags: 0x0},
+ 1074: {region: 0x37, script: 0x5, flags: 0x1},
+ 1075: {region: 0x9a, script: 0xd9, flags: 0x0},
+ 1076: {region: 0x117, script: 0x5b, flags: 0x0},
+ 1077: {region: 0x115, script: 0x5b, flags: 0x0},
+ 1078: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1079: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1080: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1081: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1082: {region: 0x6e, script: 0x5b, flags: 0x0},
+ 1083: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1084: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1085: {region: 0x61, script: 0x5b, flags: 0x0},
+ 1086: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1087: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1088: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1089: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1090: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1091: {region: 0x85, script: 0x5b, flags: 0x0},
+ 1092: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 1093: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1094: {region: 0x160, script: 0x5, flags: 0x0},
+ 1095: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 1096: {region: 0x61, script: 0x5b, flags: 0x0},
+ 1097: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1098: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1099: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1100: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1101: {region: 0x35, script: 0xe, flags: 0x0},
+ 1102: {region: 0x9c, script: 0xde, flags: 0x0},
+ 1103: {region: 0xea, script: 0x5b, flags: 0x0},
+ 1104: {region: 0x9a, script: 0xe6, flags: 0x0},
+ 1105: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1106: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1107: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1108: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1109: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1110: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1111: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1112: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1113: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1114: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1115: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1116: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1117: {region: 0x9a, script: 0x53, flags: 0x0},
+ 1118: {region: 0x53, script: 0xe4, flags: 0x0},
+ 1119: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1120: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1121: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 1122: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1123: {region: 0x113, script: 0x5b, flags: 0x0},
+ 1124: {region: 0x132, script: 0x5b, flags: 0x0},
+ 1125: {region: 0x127, script: 0x5b, flags: 0x0},
+ 1126: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1127: {region: 0x3c, script: 0x3, flags: 0x1},
+ 1128: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1129: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1130: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1131: {region: 0x124, script: 0xee, flags: 0x0},
+ 1132: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1133: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1134: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1135: {region: 0x70, script: 0x2c, flags: 0x0},
+ 1136: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1137: {region: 0x6e, script: 0x2c, flags: 0x0},
+ 1138: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1139: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1140: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1141: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 1142: {region: 0x128, script: 0x5b, flags: 0x0},
+ 1143: {region: 0x126, script: 0x5b, flags: 0x0},
+ 1144: {region: 0x32, script: 0x5b, flags: 0x0},
+ 1145: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1146: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1147: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1148: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1149: {region: 0x32, script: 0x5b, flags: 0x0},
+ 1150: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 1151: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1152: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1153: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1154: {region: 0x12a, script: 0x5b, flags: 0x0},
+ 1155: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1156: {region: 0xcf, script: 0x5b, flags: 0x0},
+ 1157: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1158: {region: 0xe7, script: 0x5b, flags: 0x0},
+ 1159: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1160: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1161: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1162: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 1163: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 1164: {region: 0x12f, script: 0x5b, flags: 0x0},
+ 1165: {region: 0x166, script: 0x5, flags: 0x0},
+ 1166: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1167: {region: 0x88, script: 0x34, flags: 0x0},
+ 1168: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1169: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1170: {region: 0x43, script: 0xef, flags: 0x0},
+ 1171: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1172: {region: 0x107, script: 0x20, flags: 0x0},
+ 1173: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1174: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1175: {region: 0x132, script: 0x5b, flags: 0x0},
+ 1176: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1177: {region: 0x124, script: 0xee, flags: 0x0},
+ 1178: {region: 0x32, script: 0x5b, flags: 0x0},
+ 1179: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1180: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1181: {region: 0xcf, script: 0x5b, flags: 0x0},
+ 1182: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1183: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1184: {region: 0x12e, script: 0x5b, flags: 0x0},
+ 1185: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1187: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1188: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 1189: {region: 0x53, script: 0xe7, flags: 0x0},
+ 1190: {region: 0xe6, script: 0x5b, flags: 0x0},
+ 1191: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1192: {region: 0x107, script: 0x20, flags: 0x0},
+ 1193: {region: 0xbb, script: 0x5b, flags: 0x0},
+ 1194: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1195: {region: 0x107, script: 0x20, flags: 0x0},
+ 1196: {region: 0x3f, script: 0x4, flags: 0x1},
+ 1197: {region: 0x11d, script: 0xf3, flags: 0x0},
+ 1198: {region: 0x131, script: 0x20, flags: 0x0},
+ 1199: {region: 0x76, script: 0x5b, flags: 0x0},
+ 1200: {region: 0x2a, script: 0x5b, flags: 0x0},
+ 1202: {region: 0x43, script: 0x3, flags: 0x1},
+ 1203: {region: 0x9a, script: 0xe, flags: 0x0},
+ 1204: {region: 0xe9, script: 0x5, flags: 0x0},
+ 1205: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1206: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1207: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1208: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1209: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1210: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1211: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1212: {region: 0x46, script: 0x4, flags: 0x1},
+ 1213: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1214: {region: 0xb5, script: 0xf4, flags: 0x0},
+ 1215: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1216: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1217: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1218: {region: 0x107, script: 0x5b, flags: 0x0},
+ 1219: {region: 0x13f, script: 0x5b, flags: 0x0},
+ 1220: {region: 0x11c, script: 0x5b, flags: 0x0},
+ 1221: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1222: {region: 0x36, script: 0x5b, flags: 0x0},
+ 1223: {region: 0x61, script: 0x5b, flags: 0x0},
+ 1224: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 1225: {region: 0x1, script: 0x5b, flags: 0x0},
+ 1226: {region: 0x107, script: 0x5b, flags: 0x0},
+ 1227: {region: 0x6b, script: 0x5b, flags: 0x0},
+ 1228: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1229: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1230: {region: 0x36, script: 0x5b, flags: 0x0},
+ 1231: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 1232: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1233: {region: 0x70, script: 0x2c, flags: 0x0},
+ 1234: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1235: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1236: {region: 0x2f, script: 0x5b, flags: 0x0},
+ 1237: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 1238: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1239: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1240: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1241: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1242: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1243: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1244: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1245: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1246: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1247: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1248: {region: 0x141, script: 0x5b, flags: 0x0},
+ 1249: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1250: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1251: {region: 0xa9, script: 0x5, flags: 0x0},
+ 1252: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1253: {region: 0x115, script: 0x5b, flags: 0x0},
+ 1254: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1255: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1256: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1257: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1258: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1259: {region: 0x53, script: 0x3b, flags: 0x0},
+ 1260: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1261: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1262: {region: 0x41, script: 0x5b, flags: 0x0},
+ 1263: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1264: {region: 0x12c, script: 0x18, flags: 0x0},
+ 1265: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1266: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1267: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1268: {region: 0x12c, script: 0x63, flags: 0x0},
+ 1269: {region: 0x12c, script: 0x64, flags: 0x0},
+ 1270: {region: 0x7e, script: 0x2e, flags: 0x0},
+ 1271: {region: 0x53, script: 0x68, flags: 0x0},
+ 1272: {region: 0x10c, script: 0x6d, flags: 0x0},
+ 1273: {region: 0x109, script: 0x79, flags: 0x0},
+ 1274: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1275: {region: 0x132, script: 0x5b, flags: 0x0},
+ 1276: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1277: {region: 0x9d, script: 0x93, flags: 0x0},
+ 1278: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1279: {region: 0x15f, script: 0xce, flags: 0x0},
+ 1280: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1281: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1282: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1283: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1284: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1285: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 1286: {region: 0x76, script: 0x5b, flags: 0x0},
+ 1287: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1288: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1289: {region: 0x52, script: 0x5b, flags: 0x0},
+ 1290: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1291: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1292: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1293: {region: 0x52, script: 0x5b, flags: 0x0},
+ 1294: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1295: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1296: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1297: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1298: {region: 0x1, script: 0x3e, flags: 0x0},
+ 1299: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1300: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1301: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1302: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1303: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1304: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 1305: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1306: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1307: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1308: {region: 0x41, script: 0x5b, flags: 0x0},
+ 1309: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1310: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 1311: {region: 0x4a, script: 0x3, flags: 0x1},
+ 1312: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1313: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1314: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1315: {region: 0x53, script: 0x5b, flags: 0x0},
+ 1316: {region: 0x10c, script: 0x5b, flags: 0x0},
+ 1318: {region: 0xa9, script: 0x5, flags: 0x0},
+ 1319: {region: 0xda, script: 0x5b, flags: 0x0},
+ 1320: {region: 0xbb, script: 0xeb, flags: 0x0},
+ 1321: {region: 0x4d, script: 0x14, flags: 0x1},
+ 1322: {region: 0x53, script: 0x7f, flags: 0x0},
+ 1323: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1324: {region: 0x123, script: 0x5b, flags: 0x0},
+ 1325: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 1326: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1327: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1329: {region: 0x12c, script: 0x5b, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 582 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+ 0: {region: 0x9d, script: 0x7, flags: 0x0},
+ 1: {region: 0xa2, script: 0x7a, flags: 0x2},
+ 2: {region: 0x11d, script: 0x87, flags: 0x2},
+ 3: {region: 0x32, script: 0x5b, flags: 0x0},
+ 4: {region: 0x9c, script: 0x5, flags: 0x4},
+ 5: {region: 0x9d, script: 0x5, flags: 0x4},
+ 6: {region: 0x107, script: 0x20, flags: 0x4},
+ 7: {region: 0x9d, script: 0x5, flags: 0x2},
+ 8: {region: 0x107, script: 0x20, flags: 0x0},
+ 9: {region: 0x38, script: 0x2f, flags: 0x2},
+ 10: {region: 0x136, script: 0x5b, flags: 0x0},
+ 11: {region: 0x7c, script: 0xd1, flags: 0x2},
+ 12: {region: 0x115, script: 0x5b, flags: 0x0},
+ 13: {region: 0x85, script: 0x1, flags: 0x2},
+ 14: {region: 0x5e, script: 0x1f, flags: 0x0},
+ 15: {region: 0x88, script: 0x60, flags: 0x2},
+ 16: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 17: {region: 0x52, script: 0x5, flags: 0x4},
+ 18: {region: 0x10c, script: 0x5, flags: 0x4},
+ 19: {region: 0xaf, script: 0x20, flags: 0x0},
+ 20: {region: 0x24, script: 0x5, flags: 0x4},
+ 21: {region: 0x53, script: 0x5, flags: 0x4},
+ 22: {region: 0x9d, script: 0x5, flags: 0x4},
+ 23: {region: 0xc6, script: 0x5, flags: 0x4},
+ 24: {region: 0x53, script: 0x5, flags: 0x2},
+ 25: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 26: {region: 0xb1, script: 0x5, flags: 0x4},
+ 27: {region: 0x9c, script: 0x5, flags: 0x2},
+ 28: {region: 0xa6, script: 0x20, flags: 0x0},
+ 29: {region: 0x53, script: 0x5, flags: 0x4},
+ 30: {region: 0x12c, script: 0x5b, flags: 0x4},
+ 31: {region: 0x53, script: 0x5, flags: 0x2},
+ 32: {region: 0x12c, script: 0x5b, flags: 0x2},
+ 33: {region: 0xdc, script: 0x22, flags: 0x0},
+ 34: {region: 0x9a, script: 0x5e, flags: 0x2},
+ 35: {region: 0x84, script: 0x5b, flags: 0x0},
+ 36: {region: 0x85, script: 0x7e, flags: 0x4},
+ 37: {region: 0x85, script: 0x7e, flags: 0x2},
+ 38: {region: 0xc6, script: 0x20, flags: 0x0},
+ 39: {region: 0x53, script: 0x71, flags: 0x4},
+ 40: {region: 0x53, script: 0x71, flags: 0x2},
+ 41: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 42: {region: 0x4a, script: 0x5, flags: 0x4},
+ 43: {region: 0x96, script: 0x5, flags: 0x4},
+ 44: {region: 0x9a, script: 0x36, flags: 0x0},
+ 45: {region: 0xe9, script: 0x5, flags: 0x4},
+ 46: {region: 0xe9, script: 0x5, flags: 0x2},
+ 47: {region: 0x9d, script: 0x8d, flags: 0x0},
+ 48: {region: 0x53, script: 0x8e, flags: 0x2},
+ 49: {region: 0xbb, script: 0xeb, flags: 0x0},
+ 50: {region: 0xda, script: 0x5b, flags: 0x4},
+ 51: {region: 0xe9, script: 0x5, flags: 0x0},
+ 52: {region: 0x9a, script: 0x22, flags: 0x2},
+ 53: {region: 0x9a, script: 0x50, flags: 0x2},
+ 54: {region: 0x9a, script: 0xd5, flags: 0x2},
+ 55: {region: 0x106, script: 0x20, flags: 0x0},
+ 56: {region: 0xbe, script: 0x5b, flags: 0x4},
+ 57: {region: 0x105, script: 0x5b, flags: 0x4},
+ 58: {region: 0x107, script: 0x5b, flags: 0x4},
+ 59: {region: 0x12c, script: 0x5b, flags: 0x4},
+ 60: {region: 0x125, script: 0x20, flags: 0x0},
+ 61: {region: 0xe9, script: 0x5, flags: 0x4},
+ 62: {region: 0xe9, script: 0x5, flags: 0x2},
+ 63: {region: 0x53, script: 0x5, flags: 0x0},
+ 64: {region: 0xaf, script: 0x20, flags: 0x4},
+ 65: {region: 0xc6, script: 0x20, flags: 0x4},
+ 66: {region: 0xaf, script: 0x20, flags: 0x2},
+ 67: {region: 0x9a, script: 0xe, flags: 0x0},
+ 68: {region: 0xdc, script: 0x22, flags: 0x4},
+ 69: {region: 0xdc, script: 0x22, flags: 0x2},
+ 70: {region: 0x138, script: 0x5b, flags: 0x0},
+ 71: {region: 0x24, script: 0x5, flags: 0x4},
+ 72: {region: 0x53, script: 0x20, flags: 0x4},
+ 73: {region: 0x24, script: 0x5, flags: 0x2},
+ 74: {region: 0x8e, script: 0x3c, flags: 0x0},
+ 75: {region: 0x53, script: 0x3b, flags: 0x4},
+ 76: {region: 0x53, script: 0x3b, flags: 0x2},
+ 77: {region: 0x53, script: 0x3b, flags: 0x0},
+ 78: {region: 0x2f, script: 0x3c, flags: 0x4},
+ 79: {region: 0x3e, script: 0x3c, flags: 0x4},
+ 80: {region: 0x7c, script: 0x3c, flags: 0x4},
+ 81: {region: 0x7f, script: 0x3c, flags: 0x4},
+ 82: {region: 0x8e, script: 0x3c, flags: 0x4},
+ 83: {region: 0x96, script: 0x3c, flags: 0x4},
+ 84: {region: 0xc7, script: 0x3c, flags: 0x4},
+ 85: {region: 0xd1, script: 0x3c, flags: 0x4},
+ 86: {region: 0xe3, script: 0x3c, flags: 0x4},
+ 87: {region: 0xe6, script: 0x3c, flags: 0x4},
+ 88: {region: 0xe8, script: 0x3c, flags: 0x4},
+ 89: {region: 0x117, script: 0x3c, flags: 0x4},
+ 90: {region: 0x124, script: 0x3c, flags: 0x4},
+ 91: {region: 0x12f, script: 0x3c, flags: 0x4},
+ 92: {region: 0x136, script: 0x3c, flags: 0x4},
+ 93: {region: 0x13f, script: 0x3c, flags: 0x4},
+ 94: {region: 0x12f, script: 0x11, flags: 0x2},
+ 95: {region: 0x12f, script: 0x37, flags: 0x2},
+ 96: {region: 0x12f, script: 0x3c, flags: 0x2},
+}
+
+type likelyLangScript struct {
+ lang uint16
+ script uint16
+ flags uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 2154 bytes, 359 elements
+var likelyRegion = [359]likelyLangScript{
+ 34: {lang: 0xd7, script: 0x5b, flags: 0x0},
+ 35: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 36: {lang: 0x0, script: 0x2, flags: 0x1},
+ 39: {lang: 0x2, script: 0x2, flags: 0x1},
+ 40: {lang: 0x4, script: 0x2, flags: 0x1},
+ 42: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 43: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 44: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 45: {lang: 0x41b, script: 0x5b, flags: 0x0},
+ 46: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 48: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 49: {lang: 0x444, script: 0x5b, flags: 0x0},
+ 50: {lang: 0x58, script: 0x5b, flags: 0x0},
+ 51: {lang: 0x6, script: 0x2, flags: 0x1},
+ 53: {lang: 0xa5, script: 0xe, flags: 0x0},
+ 54: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 55: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 56: {lang: 0x7e, script: 0x20, flags: 0x0},
+ 57: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 58: {lang: 0x3d9, script: 0x5b, flags: 0x0},
+ 59: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 60: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 62: {lang: 0x31f, script: 0x5b, flags: 0x0},
+ 63: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 64: {lang: 0x3a1, script: 0x5b, flags: 0x0},
+ 65: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 67: {lang: 0x8, script: 0x2, flags: 0x1},
+ 69: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 71: {lang: 0x71, script: 0x20, flags: 0x0},
+ 73: {lang: 0x512, script: 0x3e, flags: 0x2},
+ 74: {lang: 0x31f, script: 0x5, flags: 0x2},
+ 75: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 76: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 77: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 78: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 81: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 82: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 83: {lang: 0xa, script: 0x4, flags: 0x1},
+ 84: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 85: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 87: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 90: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 91: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 92: {lang: 0x3a1, script: 0x5b, flags: 0x0},
+ 94: {lang: 0xe, script: 0x2, flags: 0x1},
+ 95: {lang: 0xfa, script: 0x5b, flags: 0x0},
+ 97: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 99: {lang: 0x1, script: 0x5b, flags: 0x0},
+ 100: {lang: 0x101, script: 0x5b, flags: 0x0},
+ 102: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 104: {lang: 0x10, script: 0x2, flags: 0x1},
+ 105: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 106: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 107: {lang: 0x140, script: 0x5b, flags: 0x0},
+ 108: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 109: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 110: {lang: 0x46f, script: 0x2c, flags: 0x0},
+ 111: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 112: {lang: 0x12, script: 0x2, flags: 0x1},
+ 114: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 115: {lang: 0x151, script: 0x5b, flags: 0x0},
+ 116: {lang: 0x1c0, script: 0x22, flags: 0x2},
+ 119: {lang: 0x158, script: 0x5b, flags: 0x0},
+ 121: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 123: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 124: {lang: 0x14, script: 0x2, flags: 0x1},
+ 126: {lang: 0x16, script: 0x3, flags: 0x1},
+ 127: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 129: {lang: 0x21, script: 0x5b, flags: 0x0},
+ 131: {lang: 0x245, script: 0x5b, flags: 0x0},
+ 133: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 134: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 135: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 136: {lang: 0x19, script: 0x2, flags: 0x1},
+ 137: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 138: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 140: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 142: {lang: 0x529, script: 0x3c, flags: 0x0},
+ 143: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 144: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 145: {lang: 0x1d1, script: 0x5b, flags: 0x0},
+ 146: {lang: 0x1d4, script: 0x5b, flags: 0x0},
+ 147: {lang: 0x1d5, script: 0x5b, flags: 0x0},
+ 149: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 150: {lang: 0x1b, script: 0x2, flags: 0x1},
+ 152: {lang: 0x1bc, script: 0x3e, flags: 0x0},
+ 154: {lang: 0x1d, script: 0x3, flags: 0x1},
+ 156: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 157: {lang: 0x20, script: 0x2, flags: 0x1},
+ 158: {lang: 0x1f8, script: 0x5b, flags: 0x0},
+ 159: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+ 162: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 163: {lang: 0x200, script: 0x49, flags: 0x0},
+ 165: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 166: {lang: 0x28a, script: 0x20, flags: 0x0},
+ 167: {lang: 0x22, script: 0x3, flags: 0x1},
+ 169: {lang: 0x25, script: 0x2, flags: 0x1},
+ 171: {lang: 0x254, script: 0x54, flags: 0x0},
+ 172: {lang: 0x254, script: 0x54, flags: 0x0},
+ 173: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 175: {lang: 0x3e2, script: 0x20, flags: 0x0},
+ 176: {lang: 0x27, script: 0x2, flags: 0x1},
+ 177: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 179: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 180: {lang: 0x40c, script: 0xd6, flags: 0x0},
+ 182: {lang: 0x43b, script: 0x5b, flags: 0x0},
+ 183: {lang: 0x2c0, script: 0x5b, flags: 0x0},
+ 184: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 185: {lang: 0x2c7, script: 0x5b, flags: 0x0},
+ 186: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 187: {lang: 0x29, script: 0x2, flags: 0x1},
+ 188: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 189: {lang: 0x2b, script: 0x2, flags: 0x1},
+ 190: {lang: 0x432, script: 0x5b, flags: 0x0},
+ 191: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 192: {lang: 0x2f1, script: 0x5b, flags: 0x0},
+ 195: {lang: 0x2d, script: 0x2, flags: 0x1},
+ 196: {lang: 0xa0, script: 0x5b, flags: 0x0},
+ 197: {lang: 0x2f, script: 0x2, flags: 0x1},
+ 198: {lang: 0x31, script: 0x2, flags: 0x1},
+ 199: {lang: 0x33, script: 0x2, flags: 0x1},
+ 201: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 202: {lang: 0x35, script: 0x2, flags: 0x1},
+ 204: {lang: 0x320, script: 0x5b, flags: 0x0},
+ 205: {lang: 0x37, script: 0x3, flags: 0x1},
+ 206: {lang: 0x128, script: 0xed, flags: 0x0},
+ 208: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 209: {lang: 0x31f, script: 0x5b, flags: 0x0},
+ 210: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 211: {lang: 0x16, script: 0x5b, flags: 0x0},
+ 212: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 213: {lang: 0x1b4, script: 0x5b, flags: 0x0},
+ 215: {lang: 0x1b4, script: 0x5, flags: 0x2},
+ 217: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 218: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 219: {lang: 0x347, script: 0x5b, flags: 0x0},
+ 220: {lang: 0x351, script: 0x22, flags: 0x0},
+ 226: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 227: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 229: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 230: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 231: {lang: 0x486, script: 0x5b, flags: 0x0},
+ 232: {lang: 0x153, script: 0x5b, flags: 0x0},
+ 233: {lang: 0x3a, script: 0x3, flags: 0x1},
+ 234: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+ 235: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 237: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 238: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 239: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 241: {lang: 0x3a2, script: 0x5b, flags: 0x0},
+ 242: {lang: 0x194, script: 0x5b, flags: 0x0},
+ 244: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 259: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 261: {lang: 0x3d, script: 0x2, flags: 0x1},
+ 262: {lang: 0x432, script: 0x20, flags: 0x0},
+ 263: {lang: 0x3f, script: 0x2, flags: 0x1},
+ 264: {lang: 0x3e5, script: 0x5b, flags: 0x0},
+ 265: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 267: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 268: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 269: {lang: 0x41, script: 0x2, flags: 0x1},
+ 272: {lang: 0x416, script: 0x5b, flags: 0x0},
+ 273: {lang: 0x347, script: 0x5b, flags: 0x0},
+ 274: {lang: 0x43, script: 0x2, flags: 0x1},
+ 276: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+ 277: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 278: {lang: 0x429, script: 0x5b, flags: 0x0},
+ 279: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 281: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 283: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 285: {lang: 0x45, script: 0x2, flags: 0x1},
+ 289: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 290: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 291: {lang: 0x47, script: 0x2, flags: 0x1},
+ 292: {lang: 0x49, script: 0x3, flags: 0x1},
+ 293: {lang: 0x4c, script: 0x2, flags: 0x1},
+ 294: {lang: 0x477, script: 0x5b, flags: 0x0},
+ 295: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 296: {lang: 0x476, script: 0x5b, flags: 0x0},
+ 297: {lang: 0x4e, script: 0x2, flags: 0x1},
+ 298: {lang: 0x482, script: 0x5b, flags: 0x0},
+ 300: {lang: 0x50, script: 0x4, flags: 0x1},
+ 302: {lang: 0x4a0, script: 0x5b, flags: 0x0},
+ 303: {lang: 0x54, script: 0x2, flags: 0x1},
+ 304: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 305: {lang: 0x56, script: 0x3, flags: 0x1},
+ 306: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 310: {lang: 0x512, script: 0x3e, flags: 0x2},
+ 311: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 312: {lang: 0x4bc, script: 0x5b, flags: 0x0},
+ 313: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+ 316: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 319: {lang: 0x4c3, script: 0x5b, flags: 0x0},
+ 320: {lang: 0x8a, script: 0x5b, flags: 0x0},
+ 321: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 323: {lang: 0x41b, script: 0x5b, flags: 0x0},
+ 334: {lang: 0x59, script: 0x2, flags: 0x1},
+ 351: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 352: {lang: 0x5b, script: 0x2, flags: 0x1},
+ 357: {lang: 0x423, script: 0x5b, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 558 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+ 0: {lang: 0x148, script: 0x5, flags: 0x0},
+ 1: {lang: 0x476, script: 0x5b, flags: 0x0},
+ 2: {lang: 0x431, script: 0x5b, flags: 0x0},
+ 3: {lang: 0x2ff, script: 0x20, flags: 0x0},
+ 4: {lang: 0x1d7, script: 0x8, flags: 0x0},
+ 5: {lang: 0x274, script: 0x5b, flags: 0x0},
+ 6: {lang: 0xb7, script: 0x5b, flags: 0x0},
+ 7: {lang: 0x432, script: 0x20, flags: 0x0},
+ 8: {lang: 0x12d, script: 0xef, flags: 0x0},
+ 9: {lang: 0x351, script: 0x22, flags: 0x0},
+ 10: {lang: 0x529, script: 0x3b, flags: 0x0},
+ 11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+ 12: {lang: 0x523, script: 0x5b, flags: 0x0},
+ 13: {lang: 0x29a, script: 0xee, flags: 0x0},
+ 14: {lang: 0x136, script: 0x34, flags: 0x0},
+ 15: {lang: 0x48a, script: 0x5b, flags: 0x0},
+ 16: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 17: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 18: {lang: 0x27, script: 0x2c, flags: 0x0},
+ 19: {lang: 0x139, script: 0x5b, flags: 0x0},
+ 20: {lang: 0x26a, script: 0x5, flags: 0x2},
+ 21: {lang: 0x512, script: 0x3e, flags: 0x2},
+ 22: {lang: 0x210, script: 0x2e, flags: 0x0},
+ 23: {lang: 0x5, script: 0x20, flags: 0x0},
+ 24: {lang: 0x274, script: 0x5b, flags: 0x0},
+ 25: {lang: 0x136, script: 0x34, flags: 0x0},
+ 26: {lang: 0x2ff, script: 0x20, flags: 0x0},
+ 27: {lang: 0x1e1, script: 0x5b, flags: 0x0},
+ 28: {lang: 0x31f, script: 0x5, flags: 0x0},
+ 29: {lang: 0x1be, script: 0x22, flags: 0x0},
+ 30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 31: {lang: 0x236, script: 0x76, flags: 0x0},
+ 32: {lang: 0x148, script: 0x5, flags: 0x0},
+ 33: {lang: 0x476, script: 0x5b, flags: 0x0},
+ 34: {lang: 0x24a, script: 0x4f, flags: 0x0},
+ 35: {lang: 0xe6, script: 0x5, flags: 0x0},
+ 36: {lang: 0x226, script: 0xee, flags: 0x0},
+ 37: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 38: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 39: {lang: 0x2b8, script: 0x58, flags: 0x0},
+ 40: {lang: 0x226, script: 0xee, flags: 0x0},
+ 41: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 42: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 43: {lang: 0x3dc, script: 0x5b, flags: 0x0},
+ 44: {lang: 0x4ae, script: 0x20, flags: 0x0},
+ 45: {lang: 0x2ff, script: 0x20, flags: 0x0},
+ 46: {lang: 0x431, script: 0x5b, flags: 0x0},
+ 47: {lang: 0x331, script: 0x76, flags: 0x0},
+ 48: {lang: 0x213, script: 0x5b, flags: 0x0},
+ 49: {lang: 0x30b, script: 0x20, flags: 0x0},
+ 50: {lang: 0x242, script: 0x5, flags: 0x0},
+ 51: {lang: 0x529, script: 0x3c, flags: 0x0},
+ 52: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 53: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 54: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 55: {lang: 0x2ed, script: 0x5b, flags: 0x0},
+ 56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 57: {lang: 0x88, script: 0x22, flags: 0x0},
+ 58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 60: {lang: 0xbe, script: 0x22, flags: 0x0},
+ 61: {lang: 0x3dc, script: 0x5b, flags: 0x0},
+ 62: {lang: 0x7e, script: 0x20, flags: 0x0},
+ 63: {lang: 0x3e2, script: 0x20, flags: 0x0},
+ 64: {lang: 0x267, script: 0x5b, flags: 0x0},
+ 65: {lang: 0x444, script: 0x5b, flags: 0x0},
+ 66: {lang: 0x512, script: 0x3e, flags: 0x0},
+ 67: {lang: 0x412, script: 0x5b, flags: 0x0},
+ 68: {lang: 0x4ae, script: 0x20, flags: 0x0},
+ 69: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 70: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 71: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 72: {lang: 0x35, script: 0x5, flags: 0x0},
+ 73: {lang: 0x46b, script: 0xee, flags: 0x0},
+ 74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+ 75: {lang: 0x30f, script: 0x76, flags: 0x0},
+ 76: {lang: 0x467, script: 0x20, flags: 0x0},
+ 77: {lang: 0x148, script: 0x5, flags: 0x0},
+ 78: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 80: {lang: 0x48a, script: 0x5b, flags: 0x0},
+ 81: {lang: 0x58, script: 0x5, flags: 0x0},
+ 82: {lang: 0x219, script: 0x20, flags: 0x0},
+ 83: {lang: 0x81, script: 0x34, flags: 0x0},
+ 84: {lang: 0x529, script: 0x3c, flags: 0x0},
+ 85: {lang: 0x48c, script: 0x5b, flags: 0x0},
+ 86: {lang: 0x4ae, script: 0x20, flags: 0x0},
+ 87: {lang: 0x512, script: 0x3e, flags: 0x0},
+ 88: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+ 89: {lang: 0x431, script: 0x5b, flags: 0x0},
+ 90: {lang: 0x432, script: 0x20, flags: 0x0},
+ 91: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+ lang uint16
+ region uint16
+ script uint16
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+ 1: {lang: 0x139, region: 0xd7, script: 0x5b},
+ 2: {lang: 0x139, region: 0x136, script: 0x5b},
+ 3: {lang: 0x3c0, region: 0x41, script: 0x5b},
+ 4: {lang: 0x139, region: 0x2f, script: 0x5b},
+ 5: {lang: 0x139, region: 0xd7, script: 0x5b},
+ 6: {lang: 0x13e, region: 0xd0, script: 0x5b},
+ 7: {lang: 0x445, region: 0x130, script: 0x5b},
+ 8: {lang: 0x3a, region: 0x6c, script: 0x5},
+ 9: {lang: 0x445, region: 0x4b, script: 0x5b},
+ 10: {lang: 0x139, region: 0x162, script: 0x5b},
+ 11: {lang: 0x139, region: 0x136, script: 0x5b},
+ 12: {lang: 0x139, region: 0x136, script: 0x5b},
+ 13: {lang: 0x13e, region: 0x5a, script: 0x5b},
+ 14: {lang: 0x529, region: 0x53, script: 0x3b},
+ 15: {lang: 0x1be, region: 0x9a, script: 0x22},
+ 16: {lang: 0x1e1, region: 0x96, script: 0x5b},
+ 17: {lang: 0x1f9, region: 0x9f, script: 0x5b},
+ 18: {lang: 0x139, region: 0x2f, script: 0x5b},
+ 19: {lang: 0x139, region: 0xe7, script: 0x5b},
+ 20: {lang: 0x139, region: 0x8b, script: 0x5b},
+ 21: {lang: 0x41b, region: 0x143, script: 0x5b},
+ 22: {lang: 0x529, region: 0x53, script: 0x3b},
+ 23: {lang: 0x4bc, region: 0x138, script: 0x5b},
+ 24: {lang: 0x3a, region: 0x109, script: 0x5},
+ 25: {lang: 0x3e2, region: 0x107, script: 0x20},
+ 26: {lang: 0x3e2, region: 0x107, script: 0x20},
+ 27: {lang: 0x139, region: 0x7c, script: 0x5b},
+ 28: {lang: 0x10d, region: 0x61, script: 0x5b},
+ 29: {lang: 0x139, region: 0xd7, script: 0x5b},
+ 30: {lang: 0x13e, region: 0x1f, script: 0x5b},
+ 31: {lang: 0x139, region: 0x9b, script: 0x5b},
+ 32: {lang: 0x139, region: 0x7c, script: 0x5b},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+ // Entry 0 - 1F
+ 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+ 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+ 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+ 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+ 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+ 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+ 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+ // Entry 20 - 3F
+ 0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 359 bytes, 359 elements
+var regionInclusion = [359]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+ 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+ 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+ 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+ 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+ 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+ 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+ 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+ // Entry 40 - 7F
+ 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+ 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+ 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34,
+ 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e,
+ 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21,
+ 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a,
+ 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c,
+ 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28,
+ // Entry 80 - BF
+ 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27,
+ 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22,
+ 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38,
+ 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a,
+ 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31,
+ 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d,
+ 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38,
+ 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26,
+ // Entry C0 - FF
+ 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36,
+ 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f,
+ 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d,
+ 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24,
+ 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b,
+ 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a,
+ 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ // Entry 100 - 13F
+ 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33,
+ 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d,
+ 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28,
+ 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22,
+ 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31,
+ 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36,
+ 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28,
+ 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31,
+ // Entry 140 - 17F
+ 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24,
+ 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings. These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+ // Entry 0 - 1F
+ 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+ 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+ 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+ 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+ 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+ 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+ 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+ 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+ // Entry 20 - 3F
+ 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+ 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+ 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+ 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+ 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+ 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+ 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+ // Entry 40 - 5F
+ 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+ 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+ 0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+ // Entry 0 - 3F
+ 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+ 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+ 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+ 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+ 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+ 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+ 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+ 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+ // Entry 40 - 7F
+ 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+ 0x43,
+}
+
+type parentRel struct {
+ lang uint16
+ script uint16
+ maxScript uint16
+ toRegion uint16
+ fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+ 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}},
+ 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}},
+ 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}},
+ 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}},
+ 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}},
+}
+
+// Total table size 30466 bytes (29KiB); checksum: 7544152B
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 000000000..e7afd3188
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go
new file mode 100644
index 000000000..1cc004a6d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/match.go
@@ -0,0 +1,67 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package internal
+
+// This file contains matchers that implement CLDR inheritance.
+//
+// See https://unicode.org/reports/tr35/#Locale_Inheritance.
+//
+// Some of the inheritance described in this document is already handled by
+// the cldr package.
+
+import (
+ "golang.org/x/text/language"
+)
+
+// TODO: consider if (some of the) matching algorithm needs to be public after
+// getting some feel about what is generic and what is specific.
+
+// NewInheritanceMatcher returns a matcher that matches based on the inheritance
+// chain.
+//
+// The matcher uses canonicalization and the parent relationship to find a
+// match. The resulting match will always be either Und or a language with the
+// same language and script as the requested language. It will not match
+// languages for which there is understood to be mutual or one-directional
+// intelligibility.
+//
+// A Match will indicate an Exact match if the language matches after
+// canonicalization and High if the matched tag is a parent.
+func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher {
+ tags := &InheritanceMatcher{make(map[language.Tag]int)}
+ for i, tag := range t {
+ ct, err := language.All.Canonicalize(tag)
+ if err != nil {
+ ct = tag
+ }
+ tags.index[ct] = i
+ }
+ return tags
+}
+
+type InheritanceMatcher struct {
+ index map[language.Tag]int
+}
+
+func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) {
+ for _, t := range want {
+ ct, err := language.All.Canonicalize(t)
+ if err != nil {
+ ct = t
+ }
+ conf := language.Exact
+ for {
+ if index, ok := m.index[ct]; ok {
+ return ct, index, conf
+ }
+ if ct == language.Und {
+ break
+ }
+ ct = ct.Parent()
+ conf = language.High
+ }
+ }
+ return language.Und, 0, language.No
+}
diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go
new file mode 100644
index 000000000..a6e9c8e0d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/common.go
@@ -0,0 +1,55 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package number
+
+import (
+ "unicode/utf8"
+
+ "golang.org/x/text/internal/language/compact"
+)
+
+// A system identifies a CLDR numbering system.
+type system byte
+
+type systemData struct {
+ id system
+ digitSize byte // number of UTF-8 bytes per digit
+ zero [utf8.UTFMax]byte // UTF-8 sequence of zero digit.
+}
+
+// A SymbolType identifies a symbol of a specific kind.
+type SymbolType int
+
+const (
+ SymDecimal SymbolType = iota
+ SymGroup
+ SymList
+ SymPercentSign
+ SymPlusSign
+ SymMinusSign
+ SymExponential
+ SymSuperscriptingExponent
+ SymPerMille
+ SymInfinity
+ SymNan
+ SymTimeSeparator
+
+ NumSymbolTypes
+)
+
+const hasNonLatnMask = 0x8000
+
+// symOffset is an offset into altSymData if the bit indicated by hasNonLatnMask
+// is not 0 (with this bit masked out), and an offset into symIndex otherwise.
+//
+// TODO: this type can be a byte again if we use an indirection into altsymData
+// and introduce an alt -> offset slice (the length of this will be number of
+// alternatives plus 1). This also allows getting rid of the compactTag field
+// in altSymData. In total this will save about 1K.
+type symOffset uint16
+
+type altSymData struct {
+ compactTag compact.ID
+ symIndex symOffset
+ system system
+}
diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go
new file mode 100644
index 000000000..e128cf343
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/decimal.go
@@ -0,0 +1,500 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate stringer -type RoundingMode
+
+package number
+
+import (
+ "math"
+ "strconv"
+)
+
+// RoundingMode determines how a number is rounded to the desired precision.
+type RoundingMode byte
+
+const (
+ ToNearestEven RoundingMode = iota // towards the nearest integer, or towards an even number if equidistant.
+ ToNearestZero // towards the nearest integer, or towards zero if equidistant.
+ ToNearestAway // towards the nearest integer, or away from zero if equidistant.
+ ToPositiveInf // towards infinity
+ ToNegativeInf // towards negative infinity
+ ToZero // towards zero
+ AwayFromZero // away from zero
+ numModes
+)
+
+const maxIntDigits = 20
+
+// A Decimal represents a floating point number in decimal format.
+// Digits represents a number [0, 1.0), and the absolute value represented by
+// Decimal is Digits * 10^Exp. Leading and trailing zeros may be omitted and Exp
+// may point outside a valid position in Digits.
+//
+// Examples:
+//
+// Number Decimal
+// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5
+// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2
+// 12000 Digits: [1, 2], Exp: 5
+// 12000.00 Digits: [1, 2], Exp: 5
+// 0.00123 Digits: [1, 2, 3], Exp: -2
+// 0 Digits: [], Exp: 0
+type Decimal struct {
+ digits
+
+ buf [maxIntDigits]byte
+}
+
+type digits struct {
+ Digits []byte // mantissa digits, big-endian
+ Exp int32 // exponent
+ Neg bool
+ Inf bool // Takes precedence over Digits and Exp.
+ NaN bool // Takes precedence over Inf.
+}
+
+// Digits represents a floating point number represented in digits of the
+// base in which a number is to be displayed. It is similar to Decimal, but
+// keeps track of trailing fraction zeros and the comma placement for
+// engineering notation. Digits must have at least one digit.
+//
+// Examples:
+//
+// Number Decimal
+// decimal
+// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 End: 5
+// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 End: 5
+// 12000 Digits: [1, 2], Exp: 5 End: 5
+// 12000.00 Digits: [1, 2], Exp: 5 End: 7
+// 0.00123 Digits: [1, 2, 3], Exp: -2 End: 3
+// 0 Digits: [], Exp: 0 End: 1
+// scientific (actual exp is Exp - Comma)
+// 0e0 Digits: [0], Exp: 1, End: 1, Comma: 1
+// .0e0 Digits: [0], Exp: 0, End: 1, Comma: 0
+// 0.0e0 Digits: [0], Exp: 1, End: 2, Comma: 1
+// 1.23e4 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 1
+// .123e5 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 0
+// engineering
+// 12.3e3 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 2
+type Digits struct {
+ digits
+ // End indicates the end position of the number.
+ End int32 // For decimals Exp <= End. For scientific len(Digits) <= End.
+ // Comma is used for the comma position for scientific (always 0 or 1) and
+ // engineering notation (always 0, 1, 2, or 3).
+ Comma uint8
+ // IsScientific indicates whether this number is to be rendered as a
+ // scientific number.
+ IsScientific bool
+}
+
+func (d *Digits) NumFracDigits() int {
+ if d.Exp >= d.End {
+ return 0
+ }
+ return int(d.End - d.Exp)
+}
+
+// normalize returns a new Decimal with leading and trailing zeros removed.
+func (d *Decimal) normalize() (n Decimal) {
+ n = *d
+ b := n.Digits
+ // Strip leading zeros. Resulting number of digits is significant digits.
+ for len(b) > 0 && b[0] == 0 {
+ b = b[1:]
+ n.Exp--
+ }
+ // Strip trailing zeros
+ for len(b) > 0 && b[len(b)-1] == 0 {
+ b = b[:len(b)-1]
+ }
+ if len(b) == 0 {
+ n.Exp = 0
+ }
+ n.Digits = b
+ return n
+}
+
+func (d *Decimal) clear() {
+ b := d.Digits
+ if b == nil {
+ b = d.buf[:0]
+ }
+ *d = Decimal{}
+ d.Digits = b[:0]
+}
+
+func (x *Decimal) String() string {
+ if x.NaN {
+ return "NaN"
+ }
+ var buf []byte
+ if x.Neg {
+ buf = append(buf, '-')
+ }
+ if x.Inf {
+ buf = append(buf, "Inf"...)
+ return string(buf)
+ }
+ switch {
+ case len(x.Digits) == 0:
+ buf = append(buf, '0')
+ case x.Exp <= 0:
+ // 0.00ddd
+ buf = append(buf, "0."...)
+ buf = appendZeros(buf, -int(x.Exp))
+ buf = appendDigits(buf, x.Digits)
+
+ case /* 0 < */ int(x.Exp) < len(x.Digits):
+ // dd.ddd
+ buf = appendDigits(buf, x.Digits[:x.Exp])
+ buf = append(buf, '.')
+ buf = appendDigits(buf, x.Digits[x.Exp:])
+
+ default: // len(x.Digits) <= x.Exp
+ // ddd00
+ buf = appendDigits(buf, x.Digits)
+ buf = appendZeros(buf, int(x.Exp)-len(x.Digits))
+ }
+ return string(buf)
+}
+
+func appendDigits(buf []byte, digits []byte) []byte {
+ for _, c := range digits {
+ buf = append(buf, c+'0')
+ }
+ return buf
+}
+
+// appendZeros appends n 0 digits to buf and returns buf.
+func appendZeros(buf []byte, n int) []byte {
+ for ; n > 0; n-- {
+ buf = append(buf, '0')
+ }
+ return buf
+}
+
+func (d *digits) round(mode RoundingMode, n int) {
+ if n >= len(d.Digits) {
+ return
+ }
+ // Make rounding decision: The result mantissa is truncated ("rounded down")
+ // by default. Decide if we need to increment, or "round up", the (unsigned)
+ // mantissa.
+ inc := false
+ switch mode {
+ case ToNegativeInf:
+ inc = d.Neg
+ case ToPositiveInf:
+ inc = !d.Neg
+ case ToZero:
+ // nothing to do
+ case AwayFromZero:
+ inc = true
+ case ToNearestEven:
+ inc = d.Digits[n] > 5 || d.Digits[n] == 5 &&
+ (len(d.Digits) > n+1 || n == 0 || d.Digits[n-1]&1 != 0)
+ case ToNearestAway:
+ inc = d.Digits[n] >= 5
+ case ToNearestZero:
+ inc = d.Digits[n] > 5 || d.Digits[n] == 5 && len(d.Digits) > n+1
+ default:
+ panic("unreachable")
+ }
+ if inc {
+ d.roundUp(n)
+ } else {
+ d.roundDown(n)
+ }
+}
+
+// roundFloat rounds a floating point number.
+func (r RoundingMode) roundFloat(x float64) float64 {
+ // Make rounding decision: The result mantissa is truncated ("rounded down")
+ // by default. Decide if we need to increment, or "round up", the (unsigned)
+ // mantissa.
+ abs := x
+ if x < 0 {
+ abs = -x
+ }
+ i, f := math.Modf(abs)
+ if f == 0.0 {
+ return x
+ }
+ inc := false
+ switch r {
+ case ToNegativeInf:
+ inc = x < 0
+ case ToPositiveInf:
+ inc = x >= 0
+ case ToZero:
+ // nothing to do
+ case AwayFromZero:
+ inc = true
+ case ToNearestEven:
+ // TODO: check overflow
+ inc = f > 0.5 || f == 0.5 && int64(i)&1 != 0
+ case ToNearestAway:
+ inc = f >= 0.5
+ case ToNearestZero:
+ inc = f > 0.5
+ default:
+ panic("unreachable")
+ }
+ if inc {
+ i += 1
+ }
+ if abs != x {
+ i = -i
+ }
+ return i
+}
+
+func (x *digits) roundUp(n int) {
+ if n < 0 || n >= len(x.Digits) {
+ return // nothing to do
+ }
+ // find first digit < 9
+ for n > 0 && x.Digits[n-1] >= 9 {
+ n--
+ }
+
+ if n == 0 {
+ // all digits are 9s => round up to 1 and update exponent
+ x.Digits[0] = 1 // ok since len(x.Digits) > n
+ x.Digits = x.Digits[:1]
+ x.Exp++
+ return
+ }
+ x.Digits[n-1]++
+ x.Digits = x.Digits[:n]
+ // x already trimmed
+}
+
+func (x *digits) roundDown(n int) {
+ if n < 0 || n >= len(x.Digits) {
+ return // nothing to do
+ }
+ x.Digits = x.Digits[:n]
+ trim(x)
+}
+
+// trim cuts off any trailing zeros from x's mantissa;
+// they are meaningless for the value of x.
+func trim(x *digits) {
+ i := len(x.Digits)
+ for i > 0 && x.Digits[i-1] == 0 {
+ i--
+ }
+ x.Digits = x.Digits[:i]
+ if i == 0 {
+ x.Exp = 0
+ }
+}
+
+// A Converter converts a number into decimals according to the given rounding
+// criteria.
+type Converter interface {
+ Convert(d *Decimal, r RoundingContext)
+}
+
+const (
+ signed = true
+ unsigned = false
+)
+
+// Convert converts the given number to the decimal representation using the
+// supplied RoundingContext.
+func (d *Decimal) Convert(r RoundingContext, number interface{}) {
+ switch f := number.(type) {
+ case Converter:
+ d.clear()
+ f.Convert(d, r)
+ case float32:
+ d.ConvertFloat(r, float64(f), 32)
+ case float64:
+ d.ConvertFloat(r, f, 64)
+ case int:
+ d.ConvertInt(r, signed, uint64(f))
+ case int8:
+ d.ConvertInt(r, signed, uint64(f))
+ case int16:
+ d.ConvertInt(r, signed, uint64(f))
+ case int32:
+ d.ConvertInt(r, signed, uint64(f))
+ case int64:
+ d.ConvertInt(r, signed, uint64(f))
+ case uint:
+ d.ConvertInt(r, unsigned, uint64(f))
+ case uint8:
+ d.ConvertInt(r, unsigned, uint64(f))
+ case uint16:
+ d.ConvertInt(r, unsigned, uint64(f))
+ case uint32:
+ d.ConvertInt(r, unsigned, uint64(f))
+ case uint64:
+ d.ConvertInt(r, unsigned, f)
+
+ default:
+ d.NaN = true
+ // TODO:
+ // case string: if produced by strconv, allows for easy arbitrary pos.
+ // case reflect.Value:
+ // case big.Float
+ // case big.Int
+ // case big.Rat?
+ // catch underlyings using reflect or will this already be done by the
+ // message package?
+ }
+}
+
+// ConvertInt converts an integer to decimals.
+func (d *Decimal) ConvertInt(r RoundingContext, signed bool, x uint64) {
+ if r.Increment > 0 {
+ // TODO: if uint64 is too large, fall back to float64
+ if signed {
+ d.ConvertFloat(r, float64(int64(x)), 64)
+ } else {
+ d.ConvertFloat(r, float64(x), 64)
+ }
+ return
+ }
+ d.clear()
+ if signed && int64(x) < 0 {
+ x = uint64(-int64(x))
+ d.Neg = true
+ }
+ d.fillIntDigits(x)
+ d.Exp = int32(len(d.Digits))
+}
+
+// ConvertFloat converts a floating point number to decimals.
+func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) {
+ d.clear()
+ if math.IsNaN(x) {
+ d.NaN = true
+ return
+ }
+ // Simple case: decimal notation
+ if r.Increment > 0 {
+ scale := int(r.IncrementScale)
+ mult := 1.0
+ if scale >= len(scales) {
+ mult = math.Pow(10, float64(scale))
+ } else {
+ mult = scales[scale]
+ }
+ // We multiply x instead of dividing inc as it gives less rounding
+ // issues.
+ x *= mult
+ x /= float64(r.Increment)
+ x = r.Mode.roundFloat(x)
+ x *= float64(r.Increment)
+ x /= mult
+ }
+
+ abs := x
+ if x < 0 {
+ d.Neg = true
+ abs = -x
+ }
+ if math.IsInf(abs, 1) {
+ d.Inf = true
+ return
+ }
+
+ // By default we get the exact decimal representation.
+ verb := byte('g')
+ prec := -1
+ // As the strconv API does not return the rounding accuracy, we can only
+ // round using ToNearestEven.
+ if r.Mode == ToNearestEven {
+ if n := r.RoundSignificantDigits(); n >= 0 {
+ prec = n
+ } else if n = r.RoundFractionDigits(); n >= 0 {
+ prec = n
+ verb = 'f'
+ }
+ } else {
+ // TODO: At this point strconv's rounding is imprecise to the point that
+ // it is not usable for this purpose.
+ // See https://github.com/golang/go/issues/21714
+ // If rounding is requested, we ask for a large number of digits and
+ // round from there to simulate rounding only once.
+ // Ideally we would have strconv export an AppendDigits that would take
+ // a rounding mode and/or return an accuracy. Something like this would
+ // work:
+ // AppendDigits(dst []byte, x float64, base, size, prec int) (digits []byte, exp, accuracy int)
+ hasPrec := r.RoundSignificantDigits() >= 0
+ hasScale := r.RoundFractionDigits() >= 0
+ if hasPrec || hasScale {
+ // prec is the number of mantissa bits plus some extra for safety.
+ // We need at least the number of mantissa bits as decimals to
+ // accurately represent the floating point without rounding, as each
+ // bit requires one more decimal to represent: 0.5, 0.25, 0.125, ...
+ prec = 60
+ }
+ }
+
+ b := strconv.AppendFloat(d.Digits[:0], abs, verb, prec, size)
+ i := 0
+ k := 0
+ beforeDot := 1
+ for i < len(b) {
+ if c := b[i]; '0' <= c && c <= '9' {
+ b[k] = c - '0'
+ k++
+ d.Exp += int32(beforeDot)
+ } else if c == '.' {
+ beforeDot = 0
+ d.Exp = int32(k)
+ } else {
+ break
+ }
+ i++
+ }
+ d.Digits = b[:k]
+ if i != len(b) {
+ i += len("e")
+ pSign := i
+ exp := 0
+ for i++; i < len(b); i++ {
+ exp *= 10
+ exp += int(b[i] - '0')
+ }
+ if b[pSign] == '-' {
+ exp = -exp
+ }
+ d.Exp = int32(exp) + 1
+ }
+}
+
+func (d *Decimal) fillIntDigits(x uint64) {
+ if cap(d.Digits) < maxIntDigits {
+ d.Digits = d.buf[:]
+ } else {
+ d.Digits = d.buf[:maxIntDigits]
+ }
+ i := 0
+ for ; x > 0; x /= 10 {
+ d.Digits[i] = byte(x % 10)
+ i++
+ }
+ d.Digits = d.Digits[:i]
+ for p := 0; p < i; p++ {
+ i--
+ d.Digits[p], d.Digits[i] = d.Digits[i], d.Digits[p]
+ }
+}
+
+var scales [70]float64
+
+func init() {
+ x := 1.0
+ for i := range scales {
+ scales[i] = x
+ x *= 10
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go
new file mode 100644
index 000000000..cd94c5dc4
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/number/format.go
@@ -0,0 +1,535 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package number
+
+import (
+ "strconv"
+ "unicode/utf8"
+
+ "golang.org/x/text/language"
+)
+
+// TODO:
+// - grouping of fractions
+// - allow user-defined superscript notation (such as