diff --git a/.nojekyll b/.nojekyll new file mode 100644 index 0000000..e69de29 diff --git a/1_overview/index.html b/1_overview/index.html new file mode 100644 index 0000000..b323798 --- /dev/null +++ b/1_overview/index.html @@ -0,0 +1,712 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + Overview - Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + Skip to content + + +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + +
+
+
+ + + +
+
+
+ + + +
+
+ + + + + + + +

Overview

+
+

Overall objective of the workshop

+
    +
  • Introduce few "intermediate" level linux tools, trips and tricks which can be incorporated to routine tasks while dealing with Biological data formats (or any file format)
  • +
  • It may feel like the workshops lack a story (apologies in advance) but,
      +
    • Methods taught here will be used in upcoming "Advanced Shell for Bioinformatics" to design "shell" based workflows (both serial and parallel)
    • +
    • And some tools are already being used in other advanced level workshops where this material can be used as a reference
    • +
    +
  • +
+

image

+
+ + + + + + + + + + + + + +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/2_download_data/index.html b/2_download_data/index.html new file mode 100644 index 0000000..4b8079c --- /dev/null +++ b/2_download_data/index.html @@ -0,0 +1,872 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + 1. Download & Verify Data - Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + Skip to content + + +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + +
+
+
+ + + +
+
+
+ + + +
+
+ + + + + + + +

1. Download & Verify Data

+
+

Lesson Objectives

+
    +
  • Inspect data with md5 (checksum verification)
  • +
+
+
+Download with wget from a terminal client (optional) - Not required for NeSI Training platform +

wget -c https://github.com/GenomicsAotearoa/shell-for-bioinformatics/releases/download/v1.0/shell4b_data.tar.gz
+
+OR

+
wget -c https://github.com/GenomicsAotearoa/shell-for-bioinformatics/releases/download/v1.0/shell4b_data.zip
+
+
+
+
+Download via Web Browser (use locally) +
    +
  • Data can be downloaded directly from this link which will download shell4b_data.tar.gz to Downloads directory
  • +
  • If the above link fails, try this alternative .zip
  • +
+
+


+
+Recap - Decompress downloaded tar.gz OR .zip +

A TAR.GZ file is a combination of two different packaging algorithms. The first is tar, short for tape archive. It’s an old utility invented mainly for accurate data transfer to devices without their own file systems. A tar file (or tarball) contains files in a sequential format, along with metadata about the directory structure and other technical parameters.

+

It is useful to note that tar doesn’t compress the files in question, only packages them. Indeed, sometimes the resulting tarball can be of greater size due to padding. That’s where Gzip comes in. Gzip (denoted by a .gz file extension) is a compressed file format used to archive data to take up smaller space. Gzip uses the same compression algorithm as the more commonly known zip but can only be used on a single file. In short, Gzip compresses all the individual files and tar packages them in a single archive.

+
+

Decompressing the tar.gz file can be done with the built-in tar utility

+
tar -xvzf shell4b_data.tar.gz
+
+
    +
  • x: Extract an archive.
  • +
  • z: Compress the archive with gzip.
  • +
  • v: Display progress in the terminal while creating the archive, also known as “verbose” mode. The vis always optional in these commands, but it’s helpful.
  • +
  • f: Allows you to specify the filename of the archive.
  • +
+
+

ZIP files can store multiple files using different compression techniques while at the same time supports storing a file without any compression. Each file is stored/compressed individually which helps to extract them, or add new ones, without applying compression or decompression to the entire archive.

+

Each file in a ZIP archive is represented as an individual entry consisting of a Local File Header followed by the compressed file data. The Directory at the end of the archive holds the references to all these file entries. ZIP file readers should avoid reading the local file headers and all types of file listing should be read from the Directory. This Directory is the only source for valid file entries in the archive as files can be appended towards the end of the archive as well. That is why if a reader reads local headers of a ZIP archive from the beginning, it may read invalid (deleted) entries as well those are not part of the Directory being deleted from archive.

+

The order of the file entries in the central directory need not coincide with the order of file entries in the archive.

+
+

Decompressing .zip files can be done with unzip command

+
unzip -v shell4b_data.zip
+
+
    +
  • v: Display progress in the terminal while creating the archive, also known as “verbose” mode. The vis always optional in these commands, but it’s helpful.
  • +
+
+
+


+

Data Integrity

+

Data we download is the starting point of all future analyses and conclusions. Therefore it’s important to explicitly check the transferred data’s integrity with check‐sums. Checksums are very compressed summaries of data, computed in a way that even if just one bit of the data is changed the checksum will be different. As such, data integrity checks are also helpful in keeping track of data versions. Checksums facilitate reproducibility, as we can link a particular analysis and set of results to an exact version of data summarized by the data’s checksum value.

+
+

SHA and MD5 Checksums

+

Two most common checksum algorithms are MD5 and SHA (Specifically referring to SHA256)

+
    +
  • +

    MD5 : cryptographic hash function algorithm that takes the message as input of any length and changes it into a fixed-length message of 16 bytes. MD5 algorithm stands for the message-digest algorithm.

    +
  • +
  • +

    SHA : SHA-256 is a more secure and newer cryptographic hash function that was launched in 2000 as a new version of SHA functions and was adopted as Federal Information Processing Standards (FIPS) in 2002. It is allowed to use a hash generator tool to produce a SHA256 hash for any string or input value. Also, it generates 256 hash values, and the internal state size is 256 bit and the original message size is up to 264-1 bits.

    +
  • +
+
+

To create checksums, we can pass arbitrary strings to the program md5sum (or sha256sum) through standard in

+
echo "shell for Bioinformatics" | md5sum
+echo "shell for BioInformatics" | md5sum
+
+
+
198638c380be53bf3f6ff70d5626ae44  -
+afa4dbcc56b540e24558085fdc10342f  -
+
+
+
+

Checksums are reported in hexadecimal format, where each digit can be one of 16 characters: digits 0 through 9, and the letters a, b, c, d, e, and f. The trailing dash indicates this is the MD5 checksum of input from standard in. Checksums with file input can be done with md5usm filename .i.e.

+
+

code

+

NeSI training environment terminal will open with with working directory already being set to shell4b_data. If not, change directory with,

+

cd shell4b_data
+
+* Use md5sum to print the hash key

+
md5sum tb1.fasta
+
+
+
f44dca62012017196b545a2dd2d2906d  tb1.fasta
+
+
+
+

Because it can get rather tedious to check each checksum individually, both md5sum and sha256sum has a convenient solution: Let's say that we want to verify the checksums for all of the .fasta files in the current directory. (*This can be done by creating and validating against a file containing the checksums of all the .fasta files.

+
    +
  • fasta_checksums.md5 contains the checksums for three .fasta files which were verified prior to uploading to github repo. (This was generated by using the command md5sum *.fasta > fasta_checksums.md5)
  • +
  • Run the following command and see whether all the .fasta files pass the verification
      +
    • -c option represent check +
      md5sum -c fasta_checksums.md5
      +
    • +
    +
  • +
+
+
+

Applications will not trigger clear error messages for corrupted data

+

The following is an error message recorded on the log for a failed bedtools genomecov process ran on NeSI Mahuika cluster +

terminate called after throwing an instance of 'std::bad_alloc'
+what(): std::bad_alloc
+

+ +
+

std::bad_alloc is the C++ error code for when a new operator tries to allocate something, but fails. As C++ cannot dynamically allocate memory, the lack of memory is the most common cause.

+
+

So, it's quite difficult avoid the temptation to throw more memory at this process and re-run it. In fact, it was re-run with 0.5TB of memory as a sanity check which triggered the same error.

+

As it turned out, .bed file was corrupted . 🕵️‍♀️

+
+ + + + + + + + + + + + + +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/3_streams_red_pipe/index.html b/3_streams_red_pipe/index.html new file mode 100644 index 0000000..8e0e540 --- /dev/null +++ b/3_streams_red_pipe/index.html @@ -0,0 +1,1133 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + 2. Streams, Redirection and Pipe - Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + Skip to content + + +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + + + + + +
+
+ + + + + + + +

2. Streams, Redirection and Pipe

+
+

Lesson Objectives

+
    +
  • To be able to redirect streams of data in Unix.
  • +
  • Solve problems by piping several Unix commands.
  • +
  • Command substitution
  • +
+
+

Bioinformatics data is often text-based and large. This is why Unix’s philosophy of handling text streams is useful in bioinformatics: text streams allow us to do processing on a stream of data rather than holding it all in memory. Handling and redirecting the streams of data is an essential skill in Unix.

+

+image +

+

By default, both standard error and standard output of most unix programs go to your terminal screen. We can change this behavior (redirect the streams to a file) by using > or >> operators. The operator > redirects standard output to a file and overwrites any existing contents of the file, whereas >> appends to the file. If there isn’t an existing file, both operators will create it before redirecting output to it.

+

Output redirection

+

The shell4b_data directory contains the following fasta files:

+
tb1.fasta
+tb1-protein.fasta
+tga1-protein.fasta
+
+

We can use the cat command to view these files either one at a time:

+
+Recap - cat command to view the content of a file +
+

code

+
cat tb1-protein.fasta
+
+
+output +
>teosinte-branched-1 protein
+LGVPSVKHMFPFCDSSSPMDLPLYQQLQLSPSSPKTDQSSSFYCYPCSPP
+FAAADASFPLSYQIGSAAAADATPPQAVINSPDLPVQALMDHAPAPATEL
+GACASGAEGSGASLDRAAAAARKDRHSKICTAGGMRDRRMRLSLDVARKF
+FALQDMLGFDKASKTVQWLLNTSKSAIQEIMADDASSECVEDGSSSLSVD
+GKHNPAEQLGGGGDQKPKGNCRGEGKKPAKASKAAATPKPPRKSANNAHQ
+VPDKETRAKARERARERTKEKHRMRWVKLASAIDVEAAAASVPSDRPSSN
+NLSHHSSLSMNMPCAAA
+
+
+
+
+

code

+
cat tga1-protein.fasta 
+
+
+output +
>teosinte-glume-architecture-1 protein
+DSDCALSLLSAPANSSGIDVSRMVRPTEHVPMAQQPVVPGLQFGSASWFP
+RPQASTGGSFVPSCPAAVEGEQQLNAVLGPNDSEVSMNYGGMFHVGGGSG
+GGEGSSDGGT
+
+
+
+
+

OR all at once with cat *.fasta

+

We can also redirect the output to create a new file containing the sequence for both proteins:

+
+

code

+
cat tb1-protein.fasta tga1-protein.fasta > zea-proteins.fasta
+
+
+

Now we have a new file called zea-proteins.fasta. Let's check the contents:

+
+

code

+
cat zea-proteins.fasta
+
+
+output +
>teosinte-branched-1 protein
+LGVPSVKHMFPFCDSSSPMDLPLYQQLQLSPSSPKTDQSSSFYCYPCSPP
+FAAADASFPLSYQIGSAAAADATPPQAVINSPDLPVQALMDHAPAPATEL
+GACASGAEGSGASLDRAAAAARKDRHSKICTAGGMRDRRMRLSLDVARKF
+FALQDMLGFDKASKTVQWLLNTSKSAIQEIMADDASSECVEDGSSSLSVD
+GKHNPAEQLGGGGDQKPKGNCRGEGKKPAKASKAAATPKPPRKSANNAHQ
+VPDKETRAKARERARERTKEKHRMRWVKLASAIDVEAAAASVPSDRPSSN
+NLSHHSSLSMNMPCAAA
+>teosinte-glume-architecture-1 protein
+DSDCALSLLSAPANSSGIDVSRMVRPTEHVPMAQQPVVPGLQFGSASWFP
+RPQASTGGSFVPSCPAAVEGEQQLNAVLGPNDSEVSMNYGGMFHVGGGSG
+GGEGSSDGGT
+
+
+
+

Capturing error messages

+
+

code

+
cat tb1-protein.fasta mik.fasta
+
+
+
>teosinte-branched-1 protein
+LGVPSVKHMFPFCDSSSPMDLPLYQQLQLSPSSPKTDQSSSFYCYPCSPP
+FAAADASFPLSYQIGSAAAADATPPQAVINSPDLPVQALMDHAPAPATEL
+GACASGAEGSGASLDRAAAAARKDRHSKICTAGGMRDRRMRLSLDVARKF
+FALQDMLGFDKASKTVQWLLNTSKSAIQEIMADDASSECVEDGSSSLSVD
+GKHNPAEQLGGGGDQKPKGNCRGEGKKPAKASKAAATPKPPRKSANNAHQ
+VPDKETRAKARERARERTKEKHRMRWVKLASAIDVEAAAASVPSDRPSSN
+NLSHHSSLSMNMPCAAA
+cat: mik.fasta: No such file or directory
+
+
+
+

There are two different types of output there: standard output (the contents of the tb1-protein.fasta file) and standard error (the error message relating to the missing mik.fasta file). If we use the > operator to redirect the output, the standard output is captured, but the standard error is not - it is still printed to the screen. Let's check:

+
+

code

+
cat tb1-protein.fasta mik.fasta > test.fasta
+
+  cat: mik.fasta: No such file or directory
+
+
+

The new file has been created and contains the standard output (contents of the file tb1-protein.fasta):

+
+

code

+
cat test.fasta
+
+
+output +
>teosinte-branched-1 protein
+LGVPSVKHMFPFCDSSSPMDLPLYQQLQLSPSSPKTDQSSSFYCYPCSPP
+FAAADASFPLSYQIGSAAAADATPPQAVINSPDLPVQALMDHAPAPATEL
+GACASGAEGSGASLDRAAAAARKDRHSKICTAGGMRDRRMRLSLDVARKF
+FALQDMLGFDKASKTVQWLLNTSKSAIQEIMADDASSECVEDGSSSLSVD
+GKHNPAEQLGGGGDQKPKGNCRGEGKKPAKASKAAATPKPPRKSANNAHQ
+VPDKETRAKARERARERTKEKHRMRWVKLASAIDVEAAAASVPSDRPSSN
+NLSHHSSLSMNMPCAAA
+
+
+
+

If we want to capture the standard error we use the (slightly unweildy) 2> operator:

+
+

code

+
cat tb1-protein.fasta mik.fasta > test.fasta 2> stderror.txt
+
+
+
+

Descriptors

+

File descriptor 2 represents standard error (other special file descriptors include 0 for standard input and 1 for standard output).

+
+

Check the contents:

+
+

code

+
cat stderror.txt
+
+  cat: mik.fasta: No such file or directory
+
+
+
+

Reminder :> vs >>

+

Note that > will overwrite an existing file. We can use >> to add to a file instead of overwriting it:

+
+
+

code

+

cat tga1-protein.fasta >> test.fasta
+
+
cat test.fasta 
+

+
+output +
>teosinte-branched-1 protein
+LGVPSVKHMFPFCDSSSPMDLPLYQQLQLSPSSPKTDQSSSFYCYPCSPP
+FAAADASFPLSYQIGSAAAADATPPQAVINSPDLPVQALMDHAPAPATEL
+GACASGAEGSGASLDRAAAAARKDRHSKICTAGGMRDRRMRLSLDVARKF
+FALQDMLGFDKASKTVQWLLNTSKSAIQEIMADDASSECVEDGSSSLSVD
+GKHNPAEQLGGGGDQKPKGNCRGEGKKPAKASKAAATPKPPRKSANNAHQ
+VPDKETRAKARERARERTKEKHRMRWVKLASAIDVEAAAASVPSDRPSSN
+NLSHHSSLSMNMPCAAA
+>teosinte-glume-architecture-1 protein
+DSDCALSLLSAPANSSGIDVSRMVRPTEHVPMAQQPVVPGLQFGSASWFP
+RPQASTGGSFVPSCPAAVEGEQQLNAVLGPNDSEVSMNYGGMFHVGGGSG
+GGEGSSDGGT
+
+
+
+

The Unix pipe

+

The pipe operator (|) passes the output from one command to another command as input. The following is an example of using a pipe with the grep command.

+

Steps:

+
    +
  1. Remove the header information for the sequence (line starts with ">")
  2. +
  3. Highlight any characters in the sequence that are not A, T, C or G.
  4. +
+

We will use grep to carry out the first step, and then use the pipe operator to pass the output to a second grep command to carry out the second step.

+

Here is the full command:

+
+

code

+
grep -v "^>" tb1.fasta | grep --color -i "[^ATCG]"
+
+
+
+

Let's see what each piece does

+

grep -v "^>" tb1.fasta

+

The -v tells grep to search for all lines in the file tb1.fasta that do not contain a ">" at the start (^ is a special character that denotes "at the start of the line - we'll learn more about this later).

+

grep --color -i "[^ATCG]"

+

There are a few things going on here:

+
    +
  • --color: tells grep to highlight any matches
  • +
  • -i: tells grep to ignore the case (i.e., will match lower or upper case)
  • +
  • [^ATCG]: when ^ is used inside square brackets it has a different function - inverts the pattern, so that grep finds any letters that are not A, T, C or G.
  • +
+
+

Let's run the code:

+
+

code

+
grep -v "^>" tb1.fasta | grep --color -i "[^ATCG]"
+
+
+
+

CCCCAAAGACGGACCAATCCAGCAGCTTCTACTGCTAYCCATGCTCCCCTCCCTTCGCCGCCGCCGACGC

+
+

What if we had just run the code for step 2 on the tb1.fasta file?

+
+

code

+
grep --color -i "[^ATCG]" tb1.fasta
+
+
+

Combining pipes and redirection

+
+

redirect the standard output of above grep.. command to non-atcg.txt

+
grep -v "^>" tb1.fasta | grep --color -i "[^ATCG]" > non-atcg.txt
+
+
+
+

code

+
cat non-atcg.txt 
+
+
+

since we are redirecting to a text file, the --color by itself will not record the colour information. We can achieve this by invoking always flag for --color.i.e..

+
+

code

+
grep -v "^>" tb1.fasta | grep --color=always -i "[^ATCG]" > non-atcg.txt
+
+
+

Using tee to capture intermediate outputs

+
+

code

+
grep -v "^>" tb1.fasta | tee intermediate-out.txt | grep --color=always -i "[^ATCG]" > non-atcg.txt
+
+
+

The file intermediate-out.txt will contain the output from grep -v "^>" tb1.fasta, but tee also passes that output through the pipe to the next grep command.

+
+Preview - This is to be covered in "Advanced Shell for Bioinformatics"
Pipes and Chains and Long running processes : Exit Status (Programmatically Tell Whether Your Command Worked)
+

How do you know when they complete? How do you know if they successfully finished without an error? Unix programs exit with an exit status, which indicates whether a program terminated without a problem or with an error. By Unix standards, an exit status of 0 indicates the process ran successfully, and any nonzero status indicates some sort of error has occurred (and hopefully the program prints an understandable error message, too). The exit status isn’t printed to the terminal, but your shell will set its value to a shell variable named $?. We can use the echo command to look at this variable’s value after running a command:

+

program input.txt > results.txt; echo $?
+
+Exit statuses are useful because they allow us to programmatically chain commands together in the shell. A subsequent command in a chain is run conditionally on the last command’s exit status. The shell provides two operators that implement this: one operator that runs the subsequent command only if the first command completed successfully (&&), and one operator that runs the next command only if the first completed unsuccessfully (||).

+

For example, the sequence program1 input.txt > intermediate-results.txt && program2 intermediate-results.txt > results.txt will execute the second command only if previous commands have completed with a successful zero exit status.

+

By contrast, program1 input.txt > intermediate-results.txt || echo "warning: an error occurred" will print the message if error has occurred.

+
+

When a script ends with an exit that has no parameter, the exit status of the script is the exit status of the last command executed in the script (previous to the exit).

+
+
+

Exit Status : using && and ||

+

To test your understanding of && and ||, we’ll use two Unix commands that do nothing but return either exit success (true) or exit failure (false). Predict and check the outcome of the following commands:

+
true
+echo $?
+false
+echo $?
+true && echo "first command was a success"
+true || echo "first command was not a success" 
+false || echo "first command was not a success"
+false && echo "first command was a success"
+
+
+

hint

+

The $? variable represents the exit status of the previous command.

+
+
+Answer +
~$ true 
+~$ echo $?
+0
+~$ false
+~$ echo $?
+1
+~$ true && echo "first command was a success"
+first command was a success
+
+~$ true || echo "first command was not a success"
+~$ false || echo "first command was not a success"
+first command was not a success
+
+~$ false && echo "first command was a success"
+~$ 
+
+
+
+
+

Command Substitution

+

Unix users like to have the Unix shell do the work for them. This is why shell expansions like wildcards and brace expansion exist. Another type of useful shell expansion is command substitution. Command substitution runs a Unix command inline and returns the output as a string that can be used in another command. This opens up a lot of useful possibilities. For example, if you want to include the results from executing a command into a text, you can type:

+
+

Which is better ?

+

grep -c '^@' SRR097977.fastq
+
+
echo "There are $(grep -c '^@' SRR097977.fastq) entries in my FASTA file."
+

+
+

This command uses grep to count (the -c option stands for count) the number of lines matching the pattern. Using command substitution, we can calculate and return the number of FASTA entries directly into this string!

+

Another example of using command substitution would be creating dated directories:

+
+

code

+
mkdir results-$(date +%F)
+
+
+
    +
  • %F - full date; same as %Y-%m-%d
  • +
+
+
+ + + + + + + + + + + + + +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/404.html b/404.html new file mode 100644 index 0000000..d8af3a4 --- /dev/null +++ b/404.html @@ -0,0 +1,610 @@ + + + + + + + + + + + + + + + + + + + + + Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + +
+
+
+ + + +
+
+
+ + + +
+
+ +

404 - Not found

+ +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/4_inspectmanipluate/index.html b/4_inspectmanipluate/index.html new file mode 100644 index 0000000..df91dfb --- /dev/null +++ b/4_inspectmanipluate/index.html @@ -0,0 +1,1381 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + 3. Inspecting and Manipulating Text Data with Unix Tools - Part 1 - Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + Skip to content + + +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + + + + + +
+
+ + + + + + + +

3. Inspecting and Manipulating Text Data with Unix Tools - Part 1

+
+

Lesson Objectives

+
    +
  • Inspect file/s with utilities such as head,less.
  • +
  • Extracting and formatting tabular data.
  • +
  • Magical grep
  • +
  • use sort, uniq, join to manipulate the one or multiple files at once
  • +
+
+

+image +

+

Many formats in bioinformatics are simple tabular plain-text files delimited by a character. The most common tabular plain-text file format used in bioinformatics is tab-delimited. Bioinformatics evolved to favor tab-delimited formats because of the convenience of working with these files using Unix tools.

+
+

Tabular Plain-Text Data Formats

+

Tabular plain-text data formats are used extensively in computing. The basic format is +incredibly simple: each row (also known as a record) is kept on its own line, and each +column (also known as a field) is separated by some delimiter. There are three flavors +you will encounter: tab-delimited, comma-separated, and variable space-delimited.

+
+
+Recap - Inspecting data with head and tail +

Although cat command is an easy way for us to open and view the content of a file, it is not very practical to do so for a file with thousands of lines as it will exhaust the shell "space". Instead, large files should be inspected first and then manipulated accordingly. The first round of inspection can be done with head and tail command which prints the first 10 lines and the last 10 lines (-n 10) of a a file, respectively. Let's use head and tail to inspect Mus_musculus.GRCm38.75_chr1.bed

+
+

code

+
head Mus_musculus.GRCm38.75_chr1.bed
+
+
+Output +
1   3054233 3054733
+1   3054233 3054733
+1   3054233 3054733
+1   3102016 3102125
+1   3102016 3102125
+1   3102016 3102125
+1   3205901 3671498
+1   3205901 3216344
+1   3213609 3216344
+1   3205901 3207317
+
+
+
+
+

code

+
tail Mus_musculus.GRCm38.75_chr1.bed 
+
+
+Output +
1   195166217   195166390
+1   195165745   195165851
+1   195165748   195165851
+1   195165745   195165747
+1   195228278   195228398
+1   195228278   195228398
+1   195228278   195228398
+1   195240910   195241007
+1   195240910   195241007
+1   195240910   195241007
+
+
+
+

Changing the number of lines printed for either of those commands can be done by passing -n <number_of_lines> flag .i.e. Over-ride the -n 10 default

+

Try those commands with -n 4 to print top 4 lines and bottom 4 lines

+

head -n 4 Mus_musculus.GRCm38.75_chr1.bed 
+
+
tail -n 4 Mus_musculus.GRCm38.75_chr1.bed 
+

+
+


+

+
+Exercise 4.1 +

Sometimes it’s useful to see both the beginning and end of a file — for example, if we have a sorted BED file and we want to see the positions of the first feature and last feature. Can you figure out a way to use both head and tail in a single command to inspect first and last 2 lines of Mus_musculus.GRCm38.75_chr1.bed?

+
+solution +
(head -n 2; tail -n 2) < Mus_musculus.GRCm38.75_chr1.bed
+
+
+
+
+Exercise 4.2 +

We can also use tail to remove the header of a file. Normally the -n argument specifies how many of the last lines of a file to include, but if -n is given a number x preceded with a + sign (e.g., +x ), tail will start from the xth line. So to chop off a header, we start from the second line with -n+2.
+Use the seq command to generate a file containing the numbers 1 to 10, and then use the tail command to chop off the first line.

+
+solution +

seq 10 > nums.txt
+
+
cat nums.txt
+
+
tail -n+2 nums.txt
+

+
+
+

Extract summary information with wc

+

The "wc" in the wc command which stands for "word count" - this command can count the numbers of lines, words, and characters in a file (take a note on the order).

+
+

code

+
wc Mus_musculus.GRCm38.75_chr1.bed 
+
+  81226  243678 1698545 Mus_musculus.GRCm38.75_chr1.bed
+
+
+

Often, we only need to list the number of lines, which can be done by using the -l flag. It can be used as a sanity check - for example, to make sure an output has the same number of lines as the input, OR to check that a certain file format which depends on another format without losing overall data structure wasn't corrupted or over/under manipulated.

+
+

Question

+

Count the number of lines in Mus_musculus.GRCm38.75_chr1.bed and Mus_musculus.GRCm38.75_chr1.gtf . Anything out of the ordinary ?

+
+

Although wc -l is the quickest way to count the number of lines in a file, it is not the most robust as it relies on the very bad assumption that "data is well formatted"

+
+

code

+
    +
  • For an example, if we are to create a file with 3 rows of data and then two empty lines by pressing Enter twice,
  • +
+
cat > foo_wc.bed
+
+
+
  1 100
+  2 200
+  3 300
+[Press Enter]
+[Press Enter]
+
+
+

Ctrl+D to end the edits started with cat >

+
+
+

code

+
wc -l foo_wc.bed 
+
+
+
  5 foo_wc.bed
+
+
+
+

This is a good place to bring in grep again which can be used to count the number of lines while excluding white-spaces (spaces, tabs (t) or newlines (n))

+
+

code

+
grep -c "[^ \n\t]" foo_wc.bed 
+
+
+
  3
+
+
+
+

Using cut with column data and formatting tabular data with column

+

When working with plain-text tabular data formats like tab-delimited and CSV files, we often need to extract specific columns from the original file or stream. For example, suppose we wanted to extract only the start positions (the second column) of the Mus_musculus.GRCm38.75_chr1.bed file. The simplest way to do this is with cut.

+
+

code

+
cut -f 2 Mus_musculus.GRCm38.75_chr1.bed | head -n 3
+
+
+
3054233
+3054233
+3054233
+
+
+
+

-f argument is how we specify which columns to keep. It can be used to specify a range as well

+
+
+
+

code

+
cut -f 2-3 Mus_musculus.GRCm38.75_chr1.bed | head -n 3
+
+
+
 3054233   3054733
+ 3054233   3054733
+ 3054233   3054733
+
+
+
+

Using cut, we can convert our GTF for Mus_musculus.GRCm38.75_chr1.gtf to a three-column tab-delimited file of genomic ranges (e.g., chromosome, start, and end position). We’ll chop off the metadata rows using the grep command covered earlier and then use cut to extract the first, fourth, and fifth columns (chromosome, start, end):

+
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | cut -f 1,4,5 | head -n 3
+
+
+
1  3054233 3054733
+1  3054233 3054733
+1  3054233 3054733
+
+
+
+

Note that although our three-column file of genomic positions looks like a BED-formatted file, it’s not (due to subtle differences in genomic range formats).

+

cut also allows us to specify the column delimiter character. So, if we were to come across a CSV file containing chromosome names, start positions, and end positions, we could select columns from it, too:

+

As you may have noticed when working with tab-delimited files, it’s not always easy to see which elements belong to a particular column. For example:

+
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | cut -f 1-8 | head -n 3
+
+
+
  1    pseudogene  gene    3054233 3054733 .   +   .
+  1    unprocessed_pseudogene  transcript  3054233 3054733 .   +   .
+  1    unprocessed_pseudogene  exon    3054233 3054733 .   +   .
+
+
+
+

While tabs are a great delimiter in plain-text data files, our variable width data causes our columns to not stack up well. There’s a fix for this in Unix: program column -t (the -t option tells column to treat data as a table). The column -t command produces neat columns that are much easier to read:

+
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | cut -f 1-8 | column -t | head -n 3
+
+
+
   1  pseudogene                          gene         3054233    3054733    .  +  .
+   1  unprocessed_pseudogene              transcript   3054233    3054733    .  +  .
+   1  unprocessed_pseudogene              exon         3054233    3054733    .  +  .
+
+
+
+

Note that you should only use column -t to visualize data in the terminal, not to reformat data to write to a file. Tab-delimited data is preferable to data delimited by a variable number of spaces, since it’s easier for programs to parse. Like cut , column’s default delimiter is the tab character (\t ). We can specify a different delimiter with the -s option. So, if we wanted to visualize the columns of the Mus_musculus.GRCm38.75_chr1_bed.csv file more easily, we could use:

+
+

code

+
column -s "," -t Mus_musculus.GRCm38.75_chr1_bed.csv | head -n 3
+
+
+
    1  3054233 3054733
+    1  3054233 3054733
+    1  3054233 3054733
+
+
+
+
+Counting the number of columns of a .gtf with grep and wc +

GTF Format has 9 columns

+ + + + + + + + + + + + + + + + + + + + + + + + + + + +
123456789
seqnamesourcefeaturestartendscorestrandframeattribute
+

In theory, we should be able to use the following command to isolate the column headers and count the number

+

grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | head -1 | wc -w
+
+However, this will return 16 and the problem is with the attribute column which is a "A semicolon-separated list of tag-value pairs, providing additional information about each feature."

+

gene_id "ENSMUSG00000090025"; gene_name "Gm16088"; gene_source "havana"; gene_biotype "pseudogene";
+
+Therefore, we need to translate* these values to a single "new line" with tr command and then count the number of lines than than the number of words

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | head -1 | tr '\t' '\n' | wc -l
+
+
+

Sorting Plain-Text Data with sort

+

Very often we need to work with sorted plain-text data in bioinformatics. The two most common reasons to sort data are as follows:

+
    +
  • Certain operations are much more efficient when performed on sorted data.
  • +
  • Sorting data is a prerequisite to finding all unique lines.
  • +
+

sort is designed to work with plain-text data with columns.

+
+

code

+
    +
  • Create a test .bed file with few rows and use sort command without any arguments.
  • +
+
cat > test_sort.bed
+
+
+input for the test_sort.bed file +
chr1    26  39
+chr1    32  47
+chr3    11  28
+chr1    40  49
+chr3    16  27
+chr1    9   28
+chr2    35  54
+chr1    10  19
+
+
+
+
+

code

+
sort test_sort.bed 
+
+
+Output +
chr1    10  19
+chr1    26  39
+chr1    32  47
+chr1    40  49
+chr1    9   28
+chr2    35  54
+chr3    11  28
+chr3    16  27
+
+
+
+

sort without any arguments simply sorts a file alphanumerically by line. Because chromosome is the first column, sorting by line effectively groups chromosomes together, as these are "ties" in the sorted order.

+

However, using sort’s default of sorting alphanumerically by line and doesn’t handle tabular data properly. There are two new features we need:

+
    +
  • +

    The ability to sort by particular columns

    +
  • +
  • +

    The ability to tell sort that certain columns are numeric values (and not alpha‐numeric text)

    +
  • +
+

sort has a simple syntax to do this. Let’s look at how we’d sort example.bed by chromosome (first column), and start position (second column):

+
+

code

+
sort -k1,1 -k2,2n test_sort.bed
+
+
+Output +
chr1    9   28
+chr1    10  19
+chr1    26  39
+chr1    32  47
+chr1    40  49
+chr2    35  54
+chr3    11  28
+chr3    16  27
+
+
+
+
+

Here, we specify the columns (and their order) we want to sort by as -k arguments. In technical terms, -k specifies the sorting keys and their order. Each -k argument takes a range of columns as start,end, so to sort by a single column we use start,start. In the preceding example, we first sorted by the first column (chromosome), as the first -k argument was -k1,1 . Sorting by the first column alone leads to many ties in rows +with the same chromosomes (e.g., “chr1” and “chr3”). Adding a second -k argument with a different column tells sort how to break these ties. In our example, -k2,2n tells sort to sort by the second column (start position), treating this column as numerical data (because there’s an n in -k2,2n).

+

The end result is that rows are grouped by chromosome and sorted by start position.

+
+
+Exercise 4.3 +

Mus_musculus.GRCm38.75_chr1_random.gtf file is Mus_musculus.GRCm38.75_chr1.gtf with permuted rows (and without a metadata +header). Can you group rows by chromosome, and sort by position? If yes, append the output to a separate file.

+
+solution +
sort -k1,1 -k4,4n Mus_musculus.GRCm38.75_chr1_random.gtf > Mus_musculus.GRCm38.75_chr1_sorted.gtf
+
+
+
+

Finding Unique Values with uniq

+

uniq takes lines from a file or standard input stream and outputs all lines with consecutive duplicates removed. While this is a relatively simple functionality, you will use uniq very frequently in command-line data processing.

+
+

code

+
cat letters.txt 
+
+
+Output +
A 
+A
+B
+C
+B
+C
+C
+C
+
+
+
+
+

code

+
uniq letters.txt 
+
+
+
A
+B
+C
+B
+C
+
+
+
+

As you can see, uniq does not return the unique values in letters.txt — it only removes consecutive duplicate lines (keeping one). If instead we did want to find all unique lines in a file, we would first sort all lines using sort so that all identical lines are grouped next to each other, and then run uniq.

+
+

code

+
sort letters.txt | uniq
+
+
+
A
+B
+C
+
+
+
+

uniq with -c shows the counts of occurrences next to the unique lines.

+
+

code

+
sort letters.txt | uniq -c
+
+
+
      2 A
+      2 B
+      4 C
+
+
+
+

Combined with other Unix tools like cut, grep and sort, uniq can be used to summarize columns of tabular data:

+
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | cut -f3 | sort | uniq -c
+
+
+Output +
25901 CDS
+36128 exon
+2027 gene
+2290 start_codon
+2299 stop_codon
+4993 transcript
+7588 UTR
+
+
+
+

Count in order from most frequent to last

+
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | cut -f3 | sort | uniq -c | sort -rn
+
+
+
  36128 exon
+  25901 CDS
+   7588 UTR
+   4993 transcript
+   2299 stop_codon
+   2290 start_codon
+   2027 gene
+
+
+
+
+
    +
  • n and r represents numerical sort and reverse order (Or descending as the default as ascending)
  • +
+
+

Joining two files with join

+
+

Prepare

+

Create a file named example_lengths.txt with following content

+
chr1    58352
+chr2    39521
+chr3    24859
+
+
+

The Unix tool join is used to join different files together by a common column. For example, we may want to add chromosome lengths recorded in example_lengths.txt to example.bed BED file, we saw earlier. The files look like this:

+
+

code

+
cat example.bed
+echo "=========="
+cat example_lengths.txt
+
+
+
chr1   26  39
+chr1   32  47
+chr3   11  28
+chr1   40  49
+chr3   16  27
+chr1   9   28
+chr2   35  54
+chr1   10  19
+==========
+chr1   58352
+chr2   39521
+chr3   24859
+
+
+
+

To do this, we need to join both of these tabular files by their common column, the one containing the chromosome names. But first, we first need to sort both files by the column to be joined on (join would not work otherwise):

+
+

code

+

sort -k1,1 example.bed > example_sorted.bed
+
+
sort -c -k1,1 example_lengths.txt
+

+
+
+

-c, --check, --check=diagnose-first = check for sorted input; do not sort

+
+

The basic syntax is join -1 <file_1_field> -2 <file_2_field> <file_1> <file_2>. So, with example.bed and example_lengths.txt this would be:

+
+

code

+
join -1 1 -2 1 example_sorted.bed example_lengths.txt > example_with_lengths.txt
+
+
cat example_with_lengths.txt
+
+
+

There are many types of joins. For now, it’s important that we make sure join is working as we expect. Our expectation is that this join should not lead to fewer rows than in our example.bed file. We can verify this with wc -l:

+
+

code

+
wc -l example_sorted.bed example_with_lengths.txt 
+
+
+
  8 example_sorted.bed
+  8 example_with_lengths.txt
+ 16 total
+
+
+
+

However, look what happens if our second file, example_lengths.txt doesn’t have the lengths for chr3:

+
+

code

+

head -n 2 example_lengths.txt > example_lengths_alt.txt #truncate file
+
+
join -1 1 -2 1 example_sorted.bed example_lengths_alt.txt
+

+
+
chr1 10 19 58352
+chr1 26 39 58352
+chr1 32 47 58352
+chr1 40 49 58352
+chr1 9 28 58352
+chr2 35 54 39521
+
+
+
+
+

code

+
join -1 1 -2 1 example_sorted.bed example_lengths_alt.txt | wc -l
+
+
+
6
+
+
+
+

Because chr3 is absent from example_lengths_alt.txt, our join omits rows from example_sorted.bed that do not have an entry in the first column of example_lengths_alt.txt. If we don’t want this behavior, we can use option -a to include unpairable lines—ones that do not have an entry in either file:

+
+

code

+
join -1 1 -2 1 -a 1 example_sorted.bed example_lengths_alt.txt 
+
+
+

-a FILENUM - also print unpairable lines from file FILENUM, where FILENUM is 1 or 2, corresponding to FILE1 or FILE2

+
+
+
chr1 10 19 58352
+chr1 26 39 58352
+chr1 32 47 58352
+chr1 40 49 58352
+chr1 9 28 58352
+chr2 35 54 39521
+chr3 11 28
+chr3 16 27
+
+
+
+

Back to homepage

+ + + + + + + + + + + + + +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/5_inspectmanipulate2/index.html b/5_inspectmanipulate2/index.html new file mode 100644 index 0000000..70d6000 --- /dev/null +++ b/5_inspectmanipulate2/index.html @@ -0,0 +1,1486 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + 4. Inspecting and Manipulating Text Data with Unix Tools - Part 2 - Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + Skip to content + + +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + +
+
+
+ + + +
+
+
+ + + +
+
+ + + + + + + +

4. Inspecting and Manipulating Text Data with Unix Tools - Part 2

+
+

Lesson Objectives

+
    +
  • insertion, deletion, search and replace(substitution) with sed
  • +
  • Use specialised language awk to do a variety of text-processing tasks
  • +
  • Quick overview of bioawk (an extension of awk to process common biological data formats)
  • +
+
+

+image +

+

sed

+

The streamline editor or sed command is a stream editor that reads one or more text files, makes changes or edits according to editing script, and writes the results to standard output. First, we will discuss sed command with respect to search and replace function.

+

Find and Replace

+

Most common use of sed is to substitute text, matching a pattern. The syntax for doing this in sed is as follows:

+
sed 'OPERATION/REGEXP/REPLACEMENT/FLAGS' FILENAME
+
+
+
    +
  • Here, / is the delimiter (you can also use _ (underscore), | (pipe) or : (colon) as delimiter as well)
  • +
  • OPERATION specifies the action to be performed (sometimes if a condition is satisfied).
      +
    • The most common and widely used operation is s which does the substitution operation
    • +
    • Other useful operators include y for transformation, i for insertion, d for deletion etc.).
    • +
    +
  • +
  • REGEXP and REPLACEMENT specify search term and the substitution term respectively for the operation that is being performed.
  • +
  • FLAGS are additional parameters that control the operation. Some common FLAGS include:
      +
    • g replace all the instances of REGEXP with REPLACEMENT (globally)
    • +
    • N where N is any number, to replace Nth instance of the REGEXP with REPLACEMENT
    • +
    • p if substitution was made, then prints the new pattern space
    • +
    • i ignores case for matching REGEXP
    • +
    • w file If substitution was made, write out the result to the given file
    • +
    • d when specified without REPLACEMENT, deletes the found REGEXP
    • +
    +
  • +
+
+
    +
  • Some find and replace examples
  • +
+
+

Find and replace all chr to chromosome in the example.bed file and append the the edit to a new file names example_chromosome.bed

+
sed 's/chr/chromosome/g' example.bed > example_chromosome.bed
+
+
+
+

Find and replace chr to chromosome, only if you also find 40 in the line

+
    +
  • This will follow the format sed '/SEARCH_STRING/OPERATION/REGEXP/REPLACEMENT/FLAGS' FILENAME where SEARCH_STRING is 40 +
    sed '/40/s/chr/chromosome/g' example.bed > example_40.bed
    +
  • +
+
+
+

Find and replace directly on the input, but save an old version too

+
sed -i.old 's/chr/chromosome/g' example.bed
+
+
+

-i to edit files in-place instead of printing to standard output

+
+
+
    +
  • Print specific lines of the file
  • +
+

To print a specific line you can use the address function. Note that by default, sed will stream the entire file, so when you are interested in specific lines only, you will have to suppress this feature using the option -n

+
+

-n, --quiet, --silent = suppress automatic printing of pattern space

+
+
+

print 5th line of example.bed

+
sed -n '5p' example.bed
+
+
+
+

We can provide any number of additional lines to print using -e option. This tells sed to execute the next command line argument as sed program Let's print line 2 and 5,

+
sed -n -e '2p' -e '5p' example.bed
+
+
+
+

It also accepts range, using ,. Let's print line 2-6,

+
sed -n '2,6p' example.bed
+
+
+
+

Also, we can create specific pattern, like multiples of a number using ~. Let's print every tenth line of Mus_musculus.GRCm38.75_chr1.bed starting from 10, 20, 30.. to end of the file

+
sed -n '10~10p' Mus_musculus.GRCm38.75_chr1.bed
+
+
+
+Exercise 4.4 +

Can you use the above ~ trick to extract all the odd numbered lines from Mus_musculus.GRCm38.75_chr1.bed and append the output to a new file odd_sed.bed

+
+

One of the powerful features is that we can combine these ranges or multiples in any fashion. Example: fastq files have header on first line and sequence in second, next two lines will have the quality and a blank extra line (four lines make one read). Sometimes we only need the sequence and header

+
+

code

+
sed -n '1~4p;2~4p' SRR097977.fastq
+
+
+
+

Sanity Check

+

It's not a bad practice validate some of these commands by comparing the output from another command. For an example, above sed -n '1~4p;2~4p' SRR097977.fastq should print exactly half the number of lines in the file as it is removing two lines per read. Do a quick sanity check with sed -n '1~4p;2~4p' SRR097977.fastq | wc -l & cat SRR097977.fastq | wc -l

+
+
+

We can use the above trick to convert the .fastq to .fasta

+
sed -n '1~4p;2~4p' SRR097977.fastq  | sed 's/^@/>/g' > SRR097977.fasta
+
+
+


+
+Optional (Advanced) -Let's say that we want capture all the transcript names from the last column (9th column) from .gtf file. We can write something similar to: +
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | head -n 3 | sed -E 's/.*transcript_id "([^"]+)".*/\1/'
+
+
+
+

-E option to enable POSIX Extended Regular Expressions (ERE)

+
+POSIX Regular and Exetended Regular Expressions +

POSIX Basic Regular Expressions

+
    +
  • +

    POSIX or “Portable Operating System Interface for uniX” is a collection of standards that define some of the functionality that a (UNIX) operating system should support. One of these standards defines two flavors of regular expressions. Commands involving regular expressions, such as grep and egrep, implement these flavors on POSIX-compliant UNIX systems. Several database systems also use POSIX regular expressions.

    +

    The Basic Regular Expressions or BRE flavor standardizes a flavor similar to the one used by the traditional UNIX grep command. This is pretty much the oldest regular expression flavor still in use today. One thing that sets this flavor apart is that most meta-characters require a backslash to give the metacharacter its flavor. Most other flavors, including POSIX ERE, use a backslash to suppress the meaning of metacharacters. Using a backslash to escape a character that is never a metacharacter is an error.

    +
  • +
+

POSIX Extended Regular Expressions

+
    +
  • +

    The Extended Regular Expressions or ERE flavor standardizes a flavor similar to the one used by the UNIX egrep command. “Extended” is relative to the original UNIX grep, which only had bracket expressions, dot, caret, dollar and star. An ERE support these just like a BRE. Most modern regex flavors are extensions of the ERE flavor. By today’s standard, the POSIX ERE flavor is rather bare bones. The POSIX standard was defined in 1986, and regular expressions have come a long way since then.

    +

    The developers of egrep did not try to maintain compatibility with grep, creating a separate tool instead. Thus egrep, and POSIX ERE, add additional metacharacters without backslashes. You can use backslashes to suppress the meaning of all metacharacters, just like in modern regex flavors. Escaping a character that is not a meta-character is an error.

    +
  • +
+
+
+

Output is not really what we are after,

+
+
1  pseudogene  gene    3054233 3054733 .   +   .   gene_id "ENSMUSG00000090025"; gene_name "Gm16088"; gene_source "havana"; gene_biotype "pseudogene";
+ENSMUST00000160944
+ENSMUST00000160944
+
+
+

The is due to sed default behaviour where it prints every line, making replacements to matching lines. .i.e Some lines of the last column of Mus_musculus.GRCm38.75_chr1.gtf don't contain transcript_id. So, sed prints the entire line rather than captured group. One way to solve this would be to use grep transcript_id before sed to only work with lines containing the string transcript_id . However, sed offers a cleaner way. First, disable sed from outputting all lines with -n ( can use --quiet or --silent as well .i.e. suppress automatic printing of pattern space). Then, by appending p (Print the current pattern space) after the last slash sed will print all lines it’s made a replacement on. The following is an illustration of -n used with p:

+
+

code

+
grep -v "^#" Mus_musculus.GRCm38.75_chr1.gtf | head -n 3 | sed -E -n 's/.*transcript_id "([^"]+)".*/\1/p'
+
+
+

This example uses an important regular expression idiom: capturing text between delimiters (in this case, quotation marks). This is a useful pattern, so let’s break it +down:

+
    +
  1. First, match zero or more of any character ( .* ) before the string "transcript_id" .
  2. +
  3. Then, match and capture (because there are parentheses around the pattern) one or more characters that are not a quote. This is accomplished with [^"]+ , the important idiom in this example. In regular extension jargon, the brackets make up a character class. Character classes specify what characters the expression is allowed to match. Here, we use a caret ( ^ ) inside the brackets to match anything except what’s inside these brackets (in this case, a quote). The end result is that we match and capture one or more nonquote characters (because there’s a trailing + ). This approach is nongreedy; often beginners make the mistake of taking a greedy +approach and use .* . Consider:
  4. +
+
+
+

Aho, Weinberger, Kernighan = AWK

+

Awk is a scripting language used for manipulating data and generating reports. The awk command programming language requires no compiling and allows the user to use variables, numeric functions, string functions, and logical operators.

+

Awk is a utility that enables a programmer to write tiny but effective programs. These take the form of statements that define text patterns that are to be searched for in each line of a document, and the action that is to be taken when a match is found within a line.

+
+

Awk is mostly used for pattern scanning and processing. It searches one or more files to see if they contain lines that match with the specified patterns and then perform the associated actions.

+
+
+WHAT CAN WE DO WITH AWK? +
    +
  1. +

    AWK Operations:

    +
      +
    • Scans a file line by line
    • +
    • Splits each input line into fields
    • +
    • Compares input line/fields to pattern
    • +
    • Performs action(s) on matched lines
    • +
    +
  2. +
  3. +

    Useful For:

    +
      +
    • Transform data files
    • +
    • Produce formatted reports
    • +
    +
  4. +
  5. +

    Programming Constructs:

    +
      +
    • Format output lines
    • +
    • Arithmetic and string operations
    • +
    • Conditionals and loops
    • +
    +
  6. +
+
+
+

There are two key parts for understanding the Awk language: how Awk processes records, and pattern-action pairs. The rest of the language is quite simple.

+
    +
  • +

    Awk processes input data a record (line) at a time. Each record is composed of fields (column entries) that Awk automatically separates. Awk assigns the entire record to the variable $0, field one’s value to $1, field two’s value to $2, etc.

    +
  • +
  • +

    We build Awk programs using one or more of the following structures: pattern { action }. Each pattern is an expression or regular expression pattern. In Awk lingo, these are pattern-action pairs and we can chain multiple pattern-action pairs together (separated by semicolons). If we omit the pattern, Awk will run the action on all records. If we omit the action but specify a pattern, Awk will print all records that match the pattern.

    +
  • +
+
+

Syntax:

+
awk options 'selection_criteria {action}' input-file >  output-file
+
+
+

Options

+

-f program-file OR --file program-file: Reads the AWK program source from the file program-file, instead of from the first command line argument.

+

-F fsOR --field-separator fs : Use fs for the input field separator

+
+
+

Default behaviour of awk is to print every line of data from the specified file. .i.e. mimics cat

+
awk '{print}' example.bed 
+
+
+Output +
chromosome1 26  39
+chromosome1 32  47
+chromosome3 11  28
+chromosome1 40  49
+chromosome3 16  27
+chromosome1 9   28
+chromosome2 35  54
+chromosome1 10  19
+
+
+
+
+

Print lines which match the given pattern

+
awk '/chromosome1/{print}' example.bed
+
+
+
chromosome1    26  39
+chromosome1    32  47
+chromosome1    40  49
+chromosome1    9   28
+chromosome1    10  19
+
+
+
+
+

awk can be used to mimic functionality of cut

+
awk '{print $2 "\t" $3}' example.bed 
+
+
    +
  • \t for tab separated ( Refer to Special meanings of certain escaped characters in supplementary )
  • +
+
+Output +
26  39
+32  47
+11  28
+40  49
+16  27
+ 9  28
+35  54
+10  19
+
+
+
+

Here, we’re making use of Awk’s string concatenation. Two strings are concatenated if they are placed next to each other with no argument. So for each record, $2"\t"$3 concatenates the second field, a tab character, and the third field. However, this is an instance where using cut is much simpler as the equivalent of above is cut -f 2,3 example.bed

+
+

Let’s look at how we can incorporate simple pattern matching. Suppose we wanted to write a filter that only output lines where the length of the feature (end position - start position) was greater than 18. Awk supports arithmetic with the standard operators + , - , * , / , % (remainder), and ^ (exponentiation). We can subtract within a pattern to calculate the length of a feature, and filter on that expression:

+
awk '$3 - $2 > 18' example.bed
+
+
+
chromosome1    9   28
+chromosome2    35  54
+
+
+
+
+
+awk Comparison and Logical operations + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
ComparisonDescription
a == ba is equal to b
a != ba is not equal to b
a < ba is less than b
a > ba is greater than b
a <= ba is less than or equal to b
a >= ba is greater than or equal to b
a ~ ba matches regular expression pattern b
a !~ ba does not match regular expression pattern b
a && blogical a and b
a \|\| blogical or a and b
!anot a (logical negation)
+
+
+

We can also chain patterns, by using logical operators && (AND), || (OR), and ! (NOT). For example, if we wanted all lines on chromosome 1 with a length greater than 10:

+
+

code

+
awk '$1 ~ /chromosome1/ && $3 - $2 > 10' example.bed 
+
+
+
chromosome1    26  39
+chromosome1    32  47
+chromosome1    9   28
+
+
+
+
+
    +
  • First pattern, $1 ~ /chr1 specifies the regular expression (All Regular expressions are in slashes). We are matching the first field, $1 against the regular expression chr1.
  • +
  • Tilde ~ means match.
  • +
  • To do the inverse of match, we can use !~ OR !($1 ~ /chromosome1/)
  • +
+
+
+

Built-In Variables and special patterns In Awk

+
    +
  • +

    Awk’s built-in variables include the field variables $1, $2, $3, and so on ($0 is the entire line) — that break a line of text into individual words or pieces called fields.

    +
      +
    • NR: keeps a current count of the number of input records. Remember that records are usually lines. Awk command performs the pattern/action statements once for each record in a file.
    • +
    • NF: keeps a count of the number of fields within the current input record.
    • +
    • FS: contains the field separator character which is used to divide fields on the input line. The default is “white space”, meaning space and tab characters. FS can be reassigned to another character (typically in BEGIN) to change the field separator.
    • +
    • RS: stores the current record separator character. Since, by default, an input line is the input record, the default record separator character is a newline.
    • +
    • OFS: stores the output field separator, which separates the fields when Awk prints them. The default is a blank space. Whenever print has several parameters separated with commas, it will print the value of OFS in between each parameter.
    • +
    • ORS: stores the output record separator, which separates the output lines when Awk prints them. The default is a newline character. print automatically outputs the contents of ORS at the end of whatever it is given to print.
    • +
    +
  • +
  • +

    Also, there are two special patterns BEGIN & END

    +
      +
    • BEGIN - specifies what to do before the first record is read in. Useful to initialise and set up variables
    • +
    • END - what to do after the last record's processing is complete. Useful to print data summaries at the end of file processing
    • +
    +
  • +
+
+

Examples

+
+

We can use NR to extract ranges of lines, too; for example, if we wanted to extract all lines between 3 and 5 (inclusive):

+
awk 'NR >= 3 && NR <=5' example.bed
+
+
+
    chr3   11  28
+    chr1   40  49
+    chr3   16  27
+
+
+
+
+

suppose we wanted to calculate the mean feature length in example.bed. We would have to take the sum feature lengths, and then divide by the total number of records. We can do this with:

+
awk 'BEGIN{s = 0}; {s += ($3-$2)}; END{ print "mean: " s/NR};' example.bed 
+
+  mean: 14
+
+
+Explain please +

In this example, we’ve initialized a variable s to 0 in BEGIN (variables you define do not need a dollar sign). Then, for each record we increment s by the length of the feature. At the end of the records, we print this sum s divided by the number of records NR , giving the mean.

+
+
+
+

awk makes it easy to convert between bioinformatics files like BED and GTF. Can you generate a three-column BED file from Mus_muscu‐lus.GRCm38.75_chr1.gtf: ?

+
    +
  • Follow this link for a quick recap on annotation formats
  • +
  • +

    Note that the start site of features in the .bed file is 1 less than the start site of features in the .gtf file: .bed uses 0-indexing and .gtf uses 1-indexing .i.e. "chr 1 100" in a GTF/GFF is "chr 0 100" in BED

    +
  • +
  • +

    Let's build the command based on awk options 'selection_criteria {action}' input-file

    +
      +
    • What is the selection_criteria ? ( hint- it evolves around a symbol. )
    • +
    • There is a possibility of needing the "inverse of match" function in awk here which can be invoked with !
    • +
    • For {action}, we will need the field IDs of the three columns. Based on pre-existing knowledge of annotation formats, it will be feild 1, 4 and 5. Don't foget the above note on 0 vs 1 indexing of start site
    • +
    +
  • +
+
+ Help ! +
awk '!/^#/ { print $1 "\t" $4-1 "\t" $5}' Mus_musculus.GRCm38.75_chr1.gtf | head -n 3
+
+
+
1  3054232 3054733
+1  3054232 3054733
+1  3054232 3054733
+
+
+
+
+


+
+Optional (Advanced) - awk also has a very useful data structure known as an associative array. Associative arrays behave like Python’s dictionaries or hashes in other languages. We can create an associative array by simply assigning a value to a key. +

For example, suppose we wanted to count the number of features (third column) belonging to the gene “Lypla1.” We could do this by incrementing their values in an associative array:

+
awk '/Lypla1/ {feature[$3] += 1}; END {for (k in feature) print k "\t" feature[k]}' Mus_musculus.GRCm38.75_chr1.gtf 
+
+
+
exon   69
+CDS    56
+UTR    24
+gene   1
+start_codon    5
+stop_codon 5
+transcript 9
+
+
+
+Quick Intro to Arrays +

The awk language provides one-dimensional arrays for storing groups of related strings or numbers. Every awk array must have a name. Array names have the same syntax as variable names; any valid variable name would also be a valid array name. But one name cannot be used in both ways (as an array and as a variable) in the same awk program.

+

Arrays in awk superficially resemble arrays in other programming languages, but there are fundamental differences. In awk, it isn’t necessary to specify the size of an array before starting to use it. Additionally, any number or string, not just consecutive integers, may be used as an array index.

+

In most other languages, arrays must be declared before use, including a specification of how many elements or components they contain. In such languages, the declaration causes a contiguous block of memory to be allocated for that many elements. Usually, an index in the array must be a nonnegative integer. For example, the index zero specifies the first element in the array, which is actually stored at the beginning of the block of memory. Index one specifies the second element, which is stored in memory right after the first element, and so on. It is impossible to add more elements to the array, because it has room only for as many elements as given in the declaration. (Some languages allow arbitrary starting and ending indices—e.g., ‘15 .. 27’—but the size of the array is still fixed when the array is declared.)

+

A contiguous array of four elements might look like below, conceptually, if the element values are eight, "foo", "", and 30.

+

image

+

Only the values are stored; the indices are implicit from the order of the values. Here, eight is the value at index zero, because eight appears in the position with zero elements before it.

+

Arrays in awk are different—they are associative. This means that each array is a collection of pairs—an index and its corresponding array element value:

+

image

+

The pairs are shown in jumbled order because their order is irrelevant

+

One advantage of associative arrays is that new pairs can be added at any time. For example, suppose a tenth element is added to the array whose value is "number ten". The result is:

+

image

+

Now the array is sparse, which just means some indices are missing. It has elements 0–3 and 10, but doesn’t have elements 4, 5, 6, 7, 8, or 9.

+
+

It’s worth noting that there’s an entirely Unix way to count features of a particular gene: grep , cut , sort , and uniq -c

+
+

code

+
grep "Lypla1" Mus_musculus.GRCm38.75_chr1.gtf | cut -f 3 | sort | uniq -c
+
+
+

However, if we needed to also filter on column-specific information (e.g., strand), an approach using just base Unix tools would be quite messy. With Awk, adding an additional filter would be trivial: we’d just use && to add another expression in the pattern.

+
+
+

Optional - bioawk

+

bioawk is an extension of awk, adding the support of several common biological data formats, including optionally gzip'ed BED, GFF, SAM, VCF, FASTA/Q and TAB-delimited formats with column names. It also adds a few built-in functions and a command line option to use TAB as the input/output delimiter. When the new functionality is not used, bioawk is intended to behave exactly the same as the original awk.

+

The original awk requires a YACC-compatible parser generator (e.g. Byacc or Bison). bioawk further depends on zlib so as to work with gzip'd files.

+
+YACC +

A parser generator is a program that takes as input a specification of a syntax, and produces as output a procedure for recognizing that language. Historically, they are also called compiler-compilers. + YACC (yet another compiler-compiler) is an LALR(LookAhead, Left-to-right, Rightmost derivation producer with 1 lookahead token) parser generator. YACC was originally designed for being complemented by Lex.

+
    +
  • Lex (A Lexical Analyzer Generator) helps write programs whose control flow is directed by instances of regular expressions in the input stream. It is well suited for editor-script type transformations and for segmenting input in preparation for a parsing routine.
  • +
+
+
+

bioawk features

+
    +
  • It can automatically recognize some popular formats and will parse different features associated with those formats. The format option is passed to bioawk using -c arg flag. Here arg can be bed, sam, vcf, gff or fastx (for both fastq and FASTA). It can also deal with other types of table formats using the -c header option. When header is specified, the field names will used for variable names, thus greatly expanding the utility.`
  • +
  • There are several built-in functions (other than the standard awk built-ins), that are specific to biological file formats. When a format is read with bioawk, the fields get automatically parsed. You can apply several functions on these variables to get the desired output. Let’s say, we read fasta format, now we have $name and $seq that holds sequence name and sequence respectively. You can use the print function (awk built-in) to print $name and $seq. You can also use bioawk built-in with the print function to get length, reverse complement etc by using '{print length($seq)}'. Other functions include reverse, revcomp, trimq, and, or, xor etc.
  • +
+
+
+Variables for each format +

For the -c you can either specify bed, sam, vcf, gff, fastx or header. bioawk will parse these variables for the respective format. If -c header is specified, the field names (first line) will be used as variables (spaces and special characters will be changed to under_score).

+

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
bedsamvcfgfffastx
chromqnamechromseqnamename
startflagpossourceseq
endrnameidfeaturequal
nameposrefstartcomment
scoremapqaltend
strandcigarqualscore
thickstartrnextfilterfilter
thickendpnextinfostrand
rgbtlengroup
blockcountseqattribute
blocksizesqual
blockstarts
+

+
+

bioawk is not a default linux/unix utility. .i.e. Has to be installed. This is available as a module on NeSI HPC platforms which can be loaded with

+
+

code

+
module load bioawk/1.0
+
+
+

The basic idea of Bioawk is that we specify what bioinformatics format we’re working with, and Bioawk will automatically set variables for each field (just as regular Awk sets the columns of a tabular text file to $1, $1, $2, etc.). For Bioawk to set these fields, specify the format of the input file or stream with -c. Let’s look at Bioawk’s supported input formats and what variables these formats set:

+
+

code

+
bioawk
+
+
+
usage: bioawk [-F fs] [-v var=value] [-c fmt] [-tH] [-f progfile | 'prog'] [file ...]
+
+
+
bioawk -c help
+
+
+
bed:
+   1:chrom 2:start 3:end 4:name 5:score 6:strand 7:thickstart 8:thickend 9:rgb 10:blockcount 11:blocksizes 12:blockstarts 
+sam:
+   1:qname 2:flag 3:rname 4:pos 5:mapq 6:cigar 7:rnext 8:pnext 9:tlen 10:seq 11:qual 
+vcf:
+   1:chrom 2:pos 3:id 4:ref 5:alt 6:qual 7:filter 8:info 
+gff:
+   1:seqname 2:source 3:feature 4:start 5:end 6:score 7:filter 8:strand 9:group 10:attribute 
+fastx:
+   1:name 2:seq 3:qual 4:comment 
+
+
+
+

As an example of how this works, let’s read in example.bed and append a column with the length of the feature (end position - start position) for all protein coding genes:

+
+

code

+
bioawk -c gff '$3 ~ /gene/ && $2 ~ /protein_coding/ {print $seqname,$end-$start}' Mus_musculus.GRCm38.75_chr1.gtf | head -n 4
+
+
+
1  465597
+1  16807
+1  5485
+1  12533
+
+
+
+

Bioawk is also quite useful for processing FASTA/FASTQ files. For example, we could use it to turn a FASTQ file into a FASTA file:

+
+

code

+
bioawk -c fastx '{print ">"$name"\n"$seq}' SRR097977.fastq | head -n 4
+
+
+
>SRR097977.1
+TATTCTGCCATAATGAAATTCGCCACTTGTTAGTGT
+>SRR097977.2
+GGTTACTCTTTTAACCTTGATGTTTCGACGCTGTAT
+
+
+
+
+

Note that Bioawk detects whether to parse input as FASTQ or FASTA when we use -c fastx.

+
+
+

Bioawk can also serve as a method of counting the number of FASTQ/FASTA entries:

+
bioawk -c fastx 'END{print NR}' SRR097977.fastq 
+
+
+
+

Bioawk’s function revcomp() can be used to reverse complement a sequence:

+
bioawk -c fastx '{print ">"$name"\n"revcomp($seq)}' SRR097977.fastq | head -n 4
+
+
+
>SRR097977.1
+ACACTAACAAGTGGCGAATTTCATTATGGCAGAATA
+>SRR097977.2
+ATACAGCGTCGAAACATCAAGGTTAAAAGAGTAACC
+
+
+
+
+

Back to homepage

+ + + + + + + + + + + + + +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/6_automate_fileprocessing_find_xargs/index.html b/6_automate_fileprocessing_find_xargs/index.html new file mode 100644 index 0000000..4bdcac3 --- /dev/null +++ b/6_automate_fileprocessing_find_xargs/index.html @@ -0,0 +1,977 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + 5. Preview : Automating File-Processing with find and xargs - Intermediate Shell for Bioinformatics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + Skip to content + + +
+
+ +
+ + + + + + +
+ + +
+ +
+ + + + + + +
+
+ + + +
+
+
+ + + + + +
+
+
+ + + +
+
+
+ + + +
+
+
+ + + +
+
+ + + + + + + +

5. Preview : Automating File-Processing with find and xargs

+
+This section will be moved to "Advanced Shell for BioInformaitcs" +

In this section, we’ll learn about a more powerful way to specify files matching some criteria using Unix find. We’ll also see how files printed by find can be passed to another tool called xargs to create powerful Unix-based processing workflows.

+

Suppose you have a program named analyse_fastq that takes multiple filenames through a standard process. If you wanted to run this program on all files with the suffix .fastq, you might run:

+
ls *.fastq | analyse_fastq
+
+
+

Fail

+

Your shell expands this wildcard to all matching files in the current directory, and ls prints these filenames. Unfortunately, this leads to a common complication that makes ls and wildcards a fragile solution. Suppose your directory contains a filename called treatment 03.fastq. In this case, ls returns treatment 03.fastq along with other files. However, because files are separated by spaces, and this file contains a space, analyse_fastq will interpret treatment 03.fastq as two separate files, named treatment and 03.fastq. This problem crops up periodically in different ways, and it’s necessary to be aware of when writing file-processing pipelines. Note that this does not occur with file "globbing" in arguments—if analyse_fastq takes multiple files as arguments, your shell handles this properly:

+
+

Note that this does not occur with file globbing in arguments—if analyse_fastq takes multiple files as arguments, your shell handles this properly: +

analyse_fastq *.fastq
+
+Here, shell automatically escapes the space in the filename treatment 03.fastq, so analyse_fastq will correctly receive the arguments treatment-02.fastq, treatment-03.fastq,. The potential problem here is that there’s a limit to the number of files that can be specified as arguments. The limit is high, but you can reach it with NGS data. In this case you may get a meassage: : cannot execute [Argument list too long]

+
+Globbing +

Bash does not support native regular expressions like some other standard programming languages. The Bash shell feature that is used for matching or expanding specific types of patterns is called globbing. Globbing is mainly used to match filenames or searching for content in a file. Globbing uses wildcard characters to create the pattern. The most common wildcard characters that are used for creating globbing patterns are described below.

+
    +
  1. +

    Question mark – (?)

    +
      +
    • ? is used to match any single character. You can use ‘?’ for multiple times for matching multiple characters.
    • +
    +
  2. +
  3. +

    Asterisk – (*)

    +
      +
    • * is used to match zero or more characters. If you have less information to search any file or information then you can use ‘*’ in globbing pattern.
    • +
    +
  4. +
  5. +

    Square Bracket – ([])

    +
      +
    • [] is used to match the character from the range. Some of the mostly used range declarations are mentioned below.
    • +
    +
  6. +
  7. +

    Caret – (^)

    +
      +
    • You can use ^ with square bracket to define globbing pattern more specifically. ^ can be used inside or outside of square bracket. ^ is used outside the square bracket to search those contents of the file that starts with a given range of characters. ^is used inside the square bracket to show all content of the file by highlighting the lines start with a given range of characters .
    • +
    +
  8. +
+
+
+

Solution

+

Solution to both of the above problems is through find and xargs, as we will see in the following sections.

+
+

Finding files with find

+

Basic syntax for find is

+
find path expression
+
+
+

find

+
    +
  • Path specifies the starting directory for search. Expressions are how we describe which files we want to find to return
  • +
  • +

    Unlike ls, findis recursive (it will search through the directory structure). In fact, running find on a directory (without other arguments) is a quick way to see it’s structure, e.g., +

    find /nesi/project/nesi02659/| head
    +
    +
    find: /nesi/project/nesi02659/
    +/nesi/project/nesi02659/.jupyter
    +/nesi/project/nesi02659/.jupyter/share
    +/nesi/project/nesi02659/.jupyter/share/jupyter
    +/nesi/project/nesi02659/.jupyter/share/jupyter/nbconvert
    +/nesi/project/nesi02659/.jupyter/share/jupyter/nbconvert/templates
    +‘/nesi/project/nesi02659/.jupyter/share/jupyter/nbconvert/templates’: Permission denied
    +/nesi/project/nesi02659/.jupyter/share/jupyter/kernels
    +/nesi/project/nesi02659/.jupyter/share/jupyter/kernels/sismonr
    +/nesi/project/nesi02659/.jupyter/share/jupyter/kernels/sismonr/kernel.json
    +/nesi/project/nesi02659/.jupyter/share/jupyter/kernels/sismonr/logo-64x64.png
    +

    +
  • +
  • +

    Try the same command with -maxdepth 1 .i.e. +

    find /nesi/project/nesi02659/ -maxdepth 1 | head
    +

    +
  • +
+
+
+Exercise 6.1 +
    +
  1. +

    Create a small directory system as below in your current working directory

    +
    mkdir -p genome-project/{data/raw,scripts,results}
    +
    +
    touch genome-project/data/raw/bird{A,B,C}_R{1,2}.fastq
    +
    +
  2. +
  3. +

    Run find genome-project and examine the output

    +
    +Output +
    genome-project/
    +genome-project/results
    +genome-project/data
    +genome-project/data/raw
    +genome-project/data/raw/birdB_R1.fastq
    +genome-project/data/raw/birdA_R1.fastq
    +genome-project/data/raw/birdA_R2.fastq
    +genome-project/data/raw/birdC_R1.fastq
    +genome-project/data/raw/birdB_R2.fastq
    +genome-project/data/raw/birdC_R2.fastq
    +genome-project/scripts
    +
    +
    +
  4. +
  5. +

    Use find to print the names of all files matching the pattern “birdB*fastq” (e.g., FASTQ files from sample “B”, both read pairs):

    +
    find genome-project/data/raw/ -name "birdB*fastq"
    +
    +
  6. +
  7. +

    This gives similar results to ls birdB*fastq, as we’d expect. The primary difference is that find reports results separated by new lines and, by default, find is recursive. Because we only want to return fastq files (and not directories with that matching name), we might want to limit our results using the -type option: There are numerous different types you can search for; the most commonly used are ffor files, d for directories, and l for links.

    +
    find genome-project/data/raw/ -name "birdB*fastq" -type f
    +
    +
  8. +
  9. +

    By default, find connects different parts of an expression with logical AND. The find command in this case returns results where the name matches “birdB*fastq” and is a file (type “f ”). find also allows explicitly connecting different parts of an expression with different operators. +If we want to get the names of all fastq files from samples A or C, we’ll use the operator -or to chain expressions:

    +
    find genome-project/data/raw/ -name "birdA*fastq" -or -name "birdC*fastq" -type f
    +
    +
  10. +
  11. +

    Another way to select these files is with negation: Some bash versions will accept "!" as the flag for this where others will require -not

    +
    find genome-project/data/raw/ -type f -not -name "birdB*fastq"
    +
    +
  12. +
  13. +

    Suppose you were sharing this project folder with a colleague and a file named birdB_R1-temp.fastq was created by them in genome-project/data/raw but you want to ignore it in your file querying:

    +
    find genome-project/data/raw/ -type f -not -name "birdB*fastq" -and -not -name "*-temp*"
    +
    +
  14. +
+
+

finds -exec: Running Commands on find’s Results

+

find’s real strength in bioinformatics is that it allows you to run commands on every file that is returned by find, using -exec option.

+

Continuing from our last example, suppose that a collaborator created numerous temporary files. Let’s emulate this (in the genome-project/data/raw/): (then ls ensure the -temp.fastq files were created)

+
+

code

+
touch genome-project/data/raw/bird{A,C}_R{1,2}-temp.fastq
+
+
+

Although we can delete these files with rm *-temp.fastq, using rm with a wildcard in a directory filled with important data files is too risky. Using find’s -exec is a much safer way to delete these files.

+

For example, let’s use find -exec and rm to delete these temporary files:

+
+

code

+
find genome-project/data/raw/ -name "*-temp.fastq" -exec rm {} \;
+
+
+

Notice the (required!) semicolumn and curly brackets at the end of the command! . In one line, we’re able to pragmatically identify and execute a command on files that match a certain pattern. With find and -exec, a daunting task like processing a directory of 100,000 text files with a program is simple.

+

In general, find -exec is most appropriate for quick, simple tasks (like deleting files, changing permissions, etc.). For larger tasks, xargs is a better choice.

+

xargs

+

xargs reads data from standard input (stdin) and executes the command (supplied to it as an argument) one or more times based on the input read. Any spaces, tabs, and newlines in the input are treated as delimiters, while blank lines are ignored. If no command is specified, xargs executes echo. (Notice, that echo by itself does not read from standard input!)

+

xargs allows us to take input from standard in, and use this input as arguments to another program, which allows us to build commands programmatically. Using find with xargs is much like find -exec, but with some added advantages that make xargs a better choice for larger tasks.

+

Let’s re-create our -temp.fastq files: .i.e Make sure to run ls after the touch command to verify the files were created.

+
+

code

+
touch genome-project/data/raw/bird{A,C}_R{1,2}-temp.fastq
+
+
+

xargs works by taking input from standard in and splitting it by spaces, tabs, and newlines into arguments. Then, these arguments are passed to the command supplied. For example, to emulate the behavior of find -exec with rm, we use xargs with rm:

+
+

code

+
find genome-project/data/raw -name "*-temp.fastq" | xargs rm
+
+
+

One big benefit of xargs is that it separates the process that specifies the files to operate on (find) from applying a command to these files (through xargs). If we wanted to inspect a long list of files find returns before running rm on all files in this list, we could use:

+
+

code

+

touch genome-project/data/raw/bird{A,C}_R{1,2}-temp.fastq
+
+
find genome-project/data/raw/ -name "*-temp.fastq" > ohno_filestodelete.txt
+
+
cat ohno_filestodelete.txt
+
+
cat ohno_filestodelete.txt  | xargs rm
+

+
+
+

Using xargs with Replacement Strings to Apply Commands to Files

+

In addition to adding arguments at the end of the command, xargs can place them in predefined positions. This is done with the -I option and a placeholder string ({}). Suppose an imaginary program fastq_stat takes an input file through the option –in, gathers FASTQ statistics information, and then writes a summary to the file specified by the –out option. We may want our output filenames to be paired with our input filenames and have corresponding names. We can tackle this with find, xargs, and basename:

+
+
+ + + + + + + + + + + + + +
+
+ + + +
+ + + +
+ + + +
+
+
+
+ + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/assets/images/favicon.png b/assets/images/favicon.png new file mode 100644 index 0000000..1cf13b9 Binary files /dev/null and b/assets/images/favicon.png differ diff --git a/assets/javascripts/bundle.fe8b6f2b.min.js b/assets/javascripts/bundle.fe8b6f2b.min.js new file mode 100644 index 0000000..cf778d4 --- /dev/null +++ b/assets/javascripts/bundle.fe8b6f2b.min.js @@ -0,0 +1,29 @@ +"use strict";(()=>{var Fi=Object.create;var gr=Object.defineProperty;var ji=Object.getOwnPropertyDescriptor;var Wi=Object.getOwnPropertyNames,Dt=Object.getOwnPropertySymbols,Ui=Object.getPrototypeOf,xr=Object.prototype.hasOwnProperty,no=Object.prototype.propertyIsEnumerable;var oo=(e,t,r)=>t in e?gr(e,t,{enumerable:!0,configurable:!0,writable:!0,value:r}):e[t]=r,R=(e,t)=>{for(var r in t||(t={}))xr.call(t,r)&&oo(e,r,t[r]);if(Dt)for(var r of Dt(t))no.call(t,r)&&oo(e,r,t[r]);return e};var io=(e,t)=>{var r={};for(var o in e)xr.call(e,o)&&t.indexOf(o)<0&&(r[o]=e[o]);if(e!=null&&Dt)for(var o of Dt(e))t.indexOf(o)<0&&no.call(e,o)&&(r[o]=e[o]);return r};var yr=(e,t)=>()=>(t||e((t={exports:{}}).exports,t),t.exports);var Di=(e,t,r,o)=>{if(t&&typeof t=="object"||typeof t=="function")for(let n of Wi(t))!xr.call(e,n)&&n!==r&&gr(e,n,{get:()=>t[n],enumerable:!(o=ji(t,n))||o.enumerable});return e};var Vt=(e,t,r)=>(r=e!=null?Fi(Ui(e)):{},Di(t||!e||!e.__esModule?gr(r,"default",{value:e,enumerable:!0}):r,e));var ao=(e,t,r)=>new Promise((o,n)=>{var i=p=>{try{s(r.next(p))}catch(c){n(c)}},a=p=>{try{s(r.throw(p))}catch(c){n(c)}},s=p=>p.done?o(p.value):Promise.resolve(p.value).then(i,a);s((r=r.apply(e,t)).next())});var co=yr((Er,so)=>{(function(e,t){typeof Er=="object"&&typeof so!="undefined"?t():typeof define=="function"&&define.amd?define(t):t()})(Er,function(){"use strict";function e(r){var o=!0,n=!1,i=null,a={text:!0,search:!0,url:!0,tel:!0,email:!0,password:!0,number:!0,date:!0,month:!0,week:!0,time:!0,datetime:!0,"datetime-local":!0};function s(H){return!!(H&&H!==document&&H.nodeName!=="HTML"&&H.nodeName!=="BODY"&&"classList"in H&&"contains"in H.classList)}function p(H){var mt=H.type,ze=H.tagName;return!!(ze==="INPUT"&&a[mt]&&!H.readOnly||ze==="TEXTAREA"&&!H.readOnly||H.isContentEditable)}function c(H){H.classList.contains("focus-visible")||(H.classList.add("focus-visible"),H.setAttribute("data-focus-visible-added",""))}function l(H){H.hasAttribute("data-focus-visible-added")&&(H.classList.remove("focus-visible"),H.removeAttribute("data-focus-visible-added"))}function f(H){H.metaKey||H.altKey||H.ctrlKey||(s(r.activeElement)&&c(r.activeElement),o=!0)}function u(H){o=!1}function h(H){s(H.target)&&(o||p(H.target))&&c(H.target)}function w(H){s(H.target)&&(H.target.classList.contains("focus-visible")||H.target.hasAttribute("data-focus-visible-added"))&&(n=!0,window.clearTimeout(i),i=window.setTimeout(function(){n=!1},100),l(H.target))}function A(H){document.visibilityState==="hidden"&&(n&&(o=!0),te())}function te(){document.addEventListener("mousemove",J),document.addEventListener("mousedown",J),document.addEventListener("mouseup",J),document.addEventListener("pointermove",J),document.addEventListener("pointerdown",J),document.addEventListener("pointerup",J),document.addEventListener("touchmove",J),document.addEventListener("touchstart",J),document.addEventListener("touchend",J)}function ie(){document.removeEventListener("mousemove",J),document.removeEventListener("mousedown",J),document.removeEventListener("mouseup",J),document.removeEventListener("pointermove",J),document.removeEventListener("pointerdown",J),document.removeEventListener("pointerup",J),document.removeEventListener("touchmove",J),document.removeEventListener("touchstart",J),document.removeEventListener("touchend",J)}function J(H){H.target.nodeName&&H.target.nodeName.toLowerCase()==="html"||(o=!1,ie())}document.addEventListener("keydown",f,!0),document.addEventListener("mousedown",u,!0),document.addEventListener("pointerdown",u,!0),document.addEventListener("touchstart",u,!0),document.addEventListener("visibilitychange",A,!0),te(),r.addEventListener("focus",h,!0),r.addEventListener("blur",w,!0),r.nodeType===Node.DOCUMENT_FRAGMENT_NODE&&r.host?r.host.setAttribute("data-js-focus-visible",""):r.nodeType===Node.DOCUMENT_NODE&&(document.documentElement.classList.add("js-focus-visible"),document.documentElement.setAttribute("data-js-focus-visible",""))}if(typeof window!="undefined"&&typeof document!="undefined"){window.applyFocusVisiblePolyfill=e;var t;try{t=new CustomEvent("focus-visible-polyfill-ready")}catch(r){t=document.createEvent("CustomEvent"),t.initCustomEvent("focus-visible-polyfill-ready",!1,!1,{})}window.dispatchEvent(t)}typeof document!="undefined"&&e(document)})});var Yr=yr((Rt,Kr)=>{/*! + * clipboard.js v2.0.11 + * https://clipboardjs.com/ + * + * Licensed MIT © Zeno Rocha + */(function(t,r){typeof Rt=="object"&&typeof Kr=="object"?Kr.exports=r():typeof define=="function"&&define.amd?define([],r):typeof Rt=="object"?Rt.ClipboardJS=r():t.ClipboardJS=r()})(Rt,function(){return function(){var e={686:function(o,n,i){"use strict";i.d(n,{default:function(){return Ii}});var a=i(279),s=i.n(a),p=i(370),c=i.n(p),l=i(817),f=i.n(l);function u(V){try{return document.execCommand(V)}catch(_){return!1}}var h=function(_){var M=f()(_);return u("cut"),M},w=h;function A(V){var _=document.documentElement.getAttribute("dir")==="rtl",M=document.createElement("textarea");M.style.fontSize="12pt",M.style.border="0",M.style.padding="0",M.style.margin="0",M.style.position="absolute",M.style[_?"right":"left"]="-9999px";var j=window.pageYOffset||document.documentElement.scrollTop;return M.style.top="".concat(j,"px"),M.setAttribute("readonly",""),M.value=V,M}var te=function(_,M){var j=A(_);M.container.appendChild(j);var D=f()(j);return u("copy"),j.remove(),D},ie=function(_){var M=arguments.length>1&&arguments[1]!==void 0?arguments[1]:{container:document.body},j="";return typeof _=="string"?j=te(_,M):_ instanceof HTMLInputElement&&!["text","search","url","tel","password"].includes(_==null?void 0:_.type)?j=te(_.value,M):(j=f()(_),u("copy")),j},J=ie;function H(V){"@babel/helpers - typeof";return typeof Symbol=="function"&&typeof Symbol.iterator=="symbol"?H=function(M){return typeof M}:H=function(M){return M&&typeof Symbol=="function"&&M.constructor===Symbol&&M!==Symbol.prototype?"symbol":typeof M},H(V)}var mt=function(){var _=arguments.length>0&&arguments[0]!==void 0?arguments[0]:{},M=_.action,j=M===void 0?"copy":M,D=_.container,Y=_.target,ke=_.text;if(j!=="copy"&&j!=="cut")throw new Error('Invalid "action" value, use either "copy" or "cut"');if(Y!==void 0)if(Y&&H(Y)==="object"&&Y.nodeType===1){if(j==="copy"&&Y.hasAttribute("disabled"))throw new Error('Invalid "target" attribute. Please use "readonly" instead of "disabled" attribute');if(j==="cut"&&(Y.hasAttribute("readonly")||Y.hasAttribute("disabled")))throw new Error(`Invalid "target" attribute. You can't cut text from elements with "readonly" or "disabled" attributes`)}else throw new Error('Invalid "target" value, use a valid Element');if(ke)return J(ke,{container:D});if(Y)return j==="cut"?w(Y):J(Y,{container:D})},ze=mt;function Ie(V){"@babel/helpers - typeof";return typeof Symbol=="function"&&typeof Symbol.iterator=="symbol"?Ie=function(M){return typeof M}:Ie=function(M){return M&&typeof Symbol=="function"&&M.constructor===Symbol&&M!==Symbol.prototype?"symbol":typeof M},Ie(V)}function _i(V,_){if(!(V instanceof _))throw new TypeError("Cannot call a class as a function")}function ro(V,_){for(var M=0;M<_.length;M++){var j=_[M];j.enumerable=j.enumerable||!1,j.configurable=!0,"value"in j&&(j.writable=!0),Object.defineProperty(V,j.key,j)}}function Ai(V,_,M){return _&&ro(V.prototype,_),M&&ro(V,M),V}function Ci(V,_){if(typeof _!="function"&&_!==null)throw new TypeError("Super expression must either be null or a function");V.prototype=Object.create(_&&_.prototype,{constructor:{value:V,writable:!0,configurable:!0}}),_&&br(V,_)}function br(V,_){return br=Object.setPrototypeOf||function(j,D){return j.__proto__=D,j},br(V,_)}function Hi(V){var _=Pi();return function(){var j=Wt(V),D;if(_){var Y=Wt(this).constructor;D=Reflect.construct(j,arguments,Y)}else D=j.apply(this,arguments);return ki(this,D)}}function ki(V,_){return _&&(Ie(_)==="object"||typeof _=="function")?_:$i(V)}function $i(V){if(V===void 0)throw new ReferenceError("this hasn't been initialised - super() hasn't been called");return V}function Pi(){if(typeof Reflect=="undefined"||!Reflect.construct||Reflect.construct.sham)return!1;if(typeof Proxy=="function")return!0;try{return Date.prototype.toString.call(Reflect.construct(Date,[],function(){})),!0}catch(V){return!1}}function Wt(V){return Wt=Object.setPrototypeOf?Object.getPrototypeOf:function(M){return M.__proto__||Object.getPrototypeOf(M)},Wt(V)}function vr(V,_){var M="data-clipboard-".concat(V);if(_.hasAttribute(M))return _.getAttribute(M)}var Ri=function(V){Ci(M,V);var _=Hi(M);function M(j,D){var Y;return _i(this,M),Y=_.call(this),Y.resolveOptions(D),Y.listenClick(j),Y}return Ai(M,[{key:"resolveOptions",value:function(){var D=arguments.length>0&&arguments[0]!==void 0?arguments[0]:{};this.action=typeof D.action=="function"?D.action:this.defaultAction,this.target=typeof D.target=="function"?D.target:this.defaultTarget,this.text=typeof D.text=="function"?D.text:this.defaultText,this.container=Ie(D.container)==="object"?D.container:document.body}},{key:"listenClick",value:function(D){var Y=this;this.listener=c()(D,"click",function(ke){return Y.onClick(ke)})}},{key:"onClick",value:function(D){var Y=D.delegateTarget||D.currentTarget,ke=this.action(Y)||"copy",Ut=ze({action:ke,container:this.container,target:this.target(Y),text:this.text(Y)});this.emit(Ut?"success":"error",{action:ke,text:Ut,trigger:Y,clearSelection:function(){Y&&Y.focus(),window.getSelection().removeAllRanges()}})}},{key:"defaultAction",value:function(D){return vr("action",D)}},{key:"defaultTarget",value:function(D){var Y=vr("target",D);if(Y)return document.querySelector(Y)}},{key:"defaultText",value:function(D){return vr("text",D)}},{key:"destroy",value:function(){this.listener.destroy()}}],[{key:"copy",value:function(D){var Y=arguments.length>1&&arguments[1]!==void 0?arguments[1]:{container:document.body};return J(D,Y)}},{key:"cut",value:function(D){return w(D)}},{key:"isSupported",value:function(){var D=arguments.length>0&&arguments[0]!==void 0?arguments[0]:["copy","cut"],Y=typeof D=="string"?[D]:D,ke=!!document.queryCommandSupported;return Y.forEach(function(Ut){ke=ke&&!!document.queryCommandSupported(Ut)}),ke}}]),M}(s()),Ii=Ri},828:function(o){var n=9;if(typeof Element!="undefined"&&!Element.prototype.matches){var i=Element.prototype;i.matches=i.matchesSelector||i.mozMatchesSelector||i.msMatchesSelector||i.oMatchesSelector||i.webkitMatchesSelector}function a(s,p){for(;s&&s.nodeType!==n;){if(typeof s.matches=="function"&&s.matches(p))return s;s=s.parentNode}}o.exports=a},438:function(o,n,i){var a=i(828);function s(l,f,u,h,w){var A=c.apply(this,arguments);return l.addEventListener(u,A,w),{destroy:function(){l.removeEventListener(u,A,w)}}}function p(l,f,u,h,w){return typeof l.addEventListener=="function"?s.apply(null,arguments):typeof u=="function"?s.bind(null,document).apply(null,arguments):(typeof l=="string"&&(l=document.querySelectorAll(l)),Array.prototype.map.call(l,function(A){return s(A,f,u,h,w)}))}function c(l,f,u,h){return function(w){w.delegateTarget=a(w.target,f),w.delegateTarget&&h.call(l,w)}}o.exports=p},879:function(o,n){n.node=function(i){return i!==void 0&&i instanceof HTMLElement&&i.nodeType===1},n.nodeList=function(i){var a=Object.prototype.toString.call(i);return i!==void 0&&(a==="[object NodeList]"||a==="[object HTMLCollection]")&&"length"in i&&(i.length===0||n.node(i[0]))},n.string=function(i){return typeof i=="string"||i instanceof String},n.fn=function(i){var a=Object.prototype.toString.call(i);return a==="[object Function]"}},370:function(o,n,i){var a=i(879),s=i(438);function p(u,h,w){if(!u&&!h&&!w)throw new Error("Missing required arguments");if(!a.string(h))throw new TypeError("Second argument must be a String");if(!a.fn(w))throw new TypeError("Third argument must be a Function");if(a.node(u))return c(u,h,w);if(a.nodeList(u))return l(u,h,w);if(a.string(u))return f(u,h,w);throw new TypeError("First argument must be a String, HTMLElement, HTMLCollection, or NodeList")}function c(u,h,w){return u.addEventListener(h,w),{destroy:function(){u.removeEventListener(h,w)}}}function l(u,h,w){return Array.prototype.forEach.call(u,function(A){A.addEventListener(h,w)}),{destroy:function(){Array.prototype.forEach.call(u,function(A){A.removeEventListener(h,w)})}}}function f(u,h,w){return s(document.body,u,h,w)}o.exports=p},817:function(o){function n(i){var a;if(i.nodeName==="SELECT")i.focus(),a=i.value;else if(i.nodeName==="INPUT"||i.nodeName==="TEXTAREA"){var s=i.hasAttribute("readonly");s||i.setAttribute("readonly",""),i.select(),i.setSelectionRange(0,i.value.length),s||i.removeAttribute("readonly"),a=i.value}else{i.hasAttribute("contenteditable")&&i.focus();var p=window.getSelection(),c=document.createRange();c.selectNodeContents(i),p.removeAllRanges(),p.addRange(c),a=p.toString()}return a}o.exports=n},279:function(o){function n(){}n.prototype={on:function(i,a,s){var p=this.e||(this.e={});return(p[i]||(p[i]=[])).push({fn:a,ctx:s}),this},once:function(i,a,s){var p=this;function c(){p.off(i,c),a.apply(s,arguments)}return c._=a,this.on(i,c,s)},emit:function(i){var a=[].slice.call(arguments,1),s=((this.e||(this.e={}))[i]||[]).slice(),p=0,c=s.length;for(p;p{"use strict";/*! + * escape-html + * Copyright(c) 2012-2013 TJ Holowaychuk + * Copyright(c) 2015 Andreas Lubbe + * Copyright(c) 2015 Tiancheng "Timothy" Gu + * MIT Licensed + */var ts=/["'&<>]/;ei.exports=rs;function rs(e){var t=""+e,r=ts.exec(t);if(!r)return t;var o,n="",i=0,a=0;for(i=r.index;i0&&i[i.length-1])&&(c[0]===6||c[0]===2)){r=0;continue}if(c[0]===3&&(!i||c[1]>i[0]&&c[1]=e.length&&(e=void 0),{value:e&&e[o++],done:!e}}};throw new TypeError(t?"Object is not iterable.":"Symbol.iterator is not defined.")}function N(e,t){var r=typeof Symbol=="function"&&e[Symbol.iterator];if(!r)return e;var o=r.call(e),n,i=[],a;try{for(;(t===void 0||t-- >0)&&!(n=o.next()).done;)i.push(n.value)}catch(s){a={error:s}}finally{try{n&&!n.done&&(r=o.return)&&r.call(o)}finally{if(a)throw a.error}}return i}function q(e,t,r){if(r||arguments.length===2)for(var o=0,n=t.length,i;o1||s(u,h)})})}function s(u,h){try{p(o[u](h))}catch(w){f(i[0][3],w)}}function p(u){u.value instanceof nt?Promise.resolve(u.value.v).then(c,l):f(i[0][2],u)}function c(u){s("next",u)}function l(u){s("throw",u)}function f(u,h){u(h),i.shift(),i.length&&s(i[0][0],i[0][1])}}function mo(e){if(!Symbol.asyncIterator)throw new TypeError("Symbol.asyncIterator is not defined.");var t=e[Symbol.asyncIterator],r;return t?t.call(e):(e=typeof de=="function"?de(e):e[Symbol.iterator](),r={},o("next"),o("throw"),o("return"),r[Symbol.asyncIterator]=function(){return this},r);function o(i){r[i]=e[i]&&function(a){return new Promise(function(s,p){a=e[i](a),n(s,p,a.done,a.value)})}}function n(i,a,s,p){Promise.resolve(p).then(function(c){i({value:c,done:s})},a)}}function k(e){return typeof e=="function"}function ft(e){var t=function(o){Error.call(o),o.stack=new Error().stack},r=e(t);return r.prototype=Object.create(Error.prototype),r.prototype.constructor=r,r}var zt=ft(function(e){return function(r){e(this),this.message=r?r.length+` errors occurred during unsubscription: +`+r.map(function(o,n){return n+1+") "+o.toString()}).join(` + `):"",this.name="UnsubscriptionError",this.errors=r}});function qe(e,t){if(e){var r=e.indexOf(t);0<=r&&e.splice(r,1)}}var Fe=function(){function e(t){this.initialTeardown=t,this.closed=!1,this._parentage=null,this._finalizers=null}return e.prototype.unsubscribe=function(){var t,r,o,n,i;if(!this.closed){this.closed=!0;var a=this._parentage;if(a)if(this._parentage=null,Array.isArray(a))try{for(var s=de(a),p=s.next();!p.done;p=s.next()){var c=p.value;c.remove(this)}}catch(A){t={error:A}}finally{try{p&&!p.done&&(r=s.return)&&r.call(s)}finally{if(t)throw t.error}}else a.remove(this);var l=this.initialTeardown;if(k(l))try{l()}catch(A){i=A instanceof zt?A.errors:[A]}var f=this._finalizers;if(f){this._finalizers=null;try{for(var u=de(f),h=u.next();!h.done;h=u.next()){var w=h.value;try{fo(w)}catch(A){i=i!=null?i:[],A instanceof zt?i=q(q([],N(i)),N(A.errors)):i.push(A)}}}catch(A){o={error:A}}finally{try{h&&!h.done&&(n=u.return)&&n.call(u)}finally{if(o)throw o.error}}}if(i)throw new zt(i)}},e.prototype.add=function(t){var r;if(t&&t!==this)if(this.closed)fo(t);else{if(t instanceof e){if(t.closed||t._hasParent(this))return;t._addParent(this)}(this._finalizers=(r=this._finalizers)!==null&&r!==void 0?r:[]).push(t)}},e.prototype._hasParent=function(t){var r=this._parentage;return r===t||Array.isArray(r)&&r.includes(t)},e.prototype._addParent=function(t){var r=this._parentage;this._parentage=Array.isArray(r)?(r.push(t),r):r?[r,t]:t},e.prototype._removeParent=function(t){var r=this._parentage;r===t?this._parentage=null:Array.isArray(r)&&qe(r,t)},e.prototype.remove=function(t){var r=this._finalizers;r&&qe(r,t),t instanceof e&&t._removeParent(this)},e.EMPTY=function(){var t=new e;return t.closed=!0,t}(),e}();var Tr=Fe.EMPTY;function qt(e){return e instanceof Fe||e&&"closed"in e&&k(e.remove)&&k(e.add)&&k(e.unsubscribe)}function fo(e){k(e)?e():e.unsubscribe()}var $e={onUnhandledError:null,onStoppedNotification:null,Promise:void 0,useDeprecatedSynchronousErrorHandling:!1,useDeprecatedNextContext:!1};var ut={setTimeout:function(e,t){for(var r=[],o=2;o0},enumerable:!1,configurable:!0}),t.prototype._trySubscribe=function(r){return this._throwIfClosed(),e.prototype._trySubscribe.call(this,r)},t.prototype._subscribe=function(r){return this._throwIfClosed(),this._checkFinalizedStatuses(r),this._innerSubscribe(r)},t.prototype._innerSubscribe=function(r){var o=this,n=this,i=n.hasError,a=n.isStopped,s=n.observers;return i||a?Tr:(this.currentObservers=null,s.push(r),new Fe(function(){o.currentObservers=null,qe(s,r)}))},t.prototype._checkFinalizedStatuses=function(r){var o=this,n=o.hasError,i=o.thrownError,a=o.isStopped;n?r.error(i):a&&r.complete()},t.prototype.asObservable=function(){var r=new F;return r.source=this,r},t.create=function(r,o){return new Eo(r,o)},t}(F);var Eo=function(e){re(t,e);function t(r,o){var n=e.call(this)||this;return n.destination=r,n.source=o,n}return t.prototype.next=function(r){var o,n;(n=(o=this.destination)===null||o===void 0?void 0:o.next)===null||n===void 0||n.call(o,r)},t.prototype.error=function(r){var o,n;(n=(o=this.destination)===null||o===void 0?void 0:o.error)===null||n===void 0||n.call(o,r)},t.prototype.complete=function(){var r,o;(o=(r=this.destination)===null||r===void 0?void 0:r.complete)===null||o===void 0||o.call(r)},t.prototype._subscribe=function(r){var o,n;return(n=(o=this.source)===null||o===void 0?void 0:o.subscribe(r))!==null&&n!==void 0?n:Tr},t}(g);var _r=function(e){re(t,e);function t(r){var o=e.call(this)||this;return o._value=r,o}return Object.defineProperty(t.prototype,"value",{get:function(){return this.getValue()},enumerable:!1,configurable:!0}),t.prototype._subscribe=function(r){var o=e.prototype._subscribe.call(this,r);return!o.closed&&r.next(this._value),o},t.prototype.getValue=function(){var r=this,o=r.hasError,n=r.thrownError,i=r._value;if(o)throw n;return this._throwIfClosed(),i},t.prototype.next=function(r){e.prototype.next.call(this,this._value=r)},t}(g);var Lt={now:function(){return(Lt.delegate||Date).now()},delegate:void 0};var _t=function(e){re(t,e);function t(r,o,n){r===void 0&&(r=1/0),o===void 0&&(o=1/0),n===void 0&&(n=Lt);var i=e.call(this)||this;return i._bufferSize=r,i._windowTime=o,i._timestampProvider=n,i._buffer=[],i._infiniteTimeWindow=!0,i._infiniteTimeWindow=o===1/0,i._bufferSize=Math.max(1,r),i._windowTime=Math.max(1,o),i}return t.prototype.next=function(r){var o=this,n=o.isStopped,i=o._buffer,a=o._infiniteTimeWindow,s=o._timestampProvider,p=o._windowTime;n||(i.push(r),!a&&i.push(s.now()+p)),this._trimBuffer(),e.prototype.next.call(this,r)},t.prototype._subscribe=function(r){this._throwIfClosed(),this._trimBuffer();for(var o=this._innerSubscribe(r),n=this,i=n._infiniteTimeWindow,a=n._buffer,s=a.slice(),p=0;p0?e.prototype.schedule.call(this,r,o):(this.delay=o,this.state=r,this.scheduler.flush(this),this)},t.prototype.execute=function(r,o){return o>0||this.closed?e.prototype.execute.call(this,r,o):this._execute(r,o)},t.prototype.requestAsyncId=function(r,o,n){return n===void 0&&(n=0),n!=null&&n>0||n==null&&this.delay>0?e.prototype.requestAsyncId.call(this,r,o,n):(r.flush(this),0)},t}(vt);var So=function(e){re(t,e);function t(){return e!==null&&e.apply(this,arguments)||this}return t}(gt);var Hr=new So(To);var Oo=function(e){re(t,e);function t(r,o){var n=e.call(this,r,o)||this;return n.scheduler=r,n.work=o,n}return t.prototype.requestAsyncId=function(r,o,n){return n===void 0&&(n=0),n!==null&&n>0?e.prototype.requestAsyncId.call(this,r,o,n):(r.actions.push(this),r._scheduled||(r._scheduled=bt.requestAnimationFrame(function(){return r.flush(void 0)})))},t.prototype.recycleAsyncId=function(r,o,n){var i;if(n===void 0&&(n=0),n!=null?n>0:this.delay>0)return e.prototype.recycleAsyncId.call(this,r,o,n);var a=r.actions;o!=null&&((i=a[a.length-1])===null||i===void 0?void 0:i.id)!==o&&(bt.cancelAnimationFrame(o),r._scheduled=void 0)},t}(vt);var Mo=function(e){re(t,e);function t(){return e!==null&&e.apply(this,arguments)||this}return t.prototype.flush=function(r){this._active=!0;var o=this._scheduled;this._scheduled=void 0;var n=this.actions,i;r=r||n.shift();do if(i=r.execute(r.state,r.delay))break;while((r=n[0])&&r.id===o&&n.shift());if(this._active=!1,i){for(;(r=n[0])&&r.id===o&&n.shift();)r.unsubscribe();throw i}},t}(gt);var me=new Mo(Oo);var O=new F(function(e){return e.complete()});function Yt(e){return e&&k(e.schedule)}function kr(e){return e[e.length-1]}function Xe(e){return k(kr(e))?e.pop():void 0}function He(e){return Yt(kr(e))?e.pop():void 0}function Bt(e,t){return typeof kr(e)=="number"?e.pop():t}var xt=function(e){return e&&typeof e.length=="number"&&typeof e!="function"};function Gt(e){return k(e==null?void 0:e.then)}function Jt(e){return k(e[ht])}function Xt(e){return Symbol.asyncIterator&&k(e==null?void 0:e[Symbol.asyncIterator])}function Zt(e){return new TypeError("You provided "+(e!==null&&typeof e=="object"?"an invalid object":"'"+e+"'")+" where a stream was expected. You can provide an Observable, Promise, ReadableStream, Array, AsyncIterable, or Iterable.")}function Gi(){return typeof Symbol!="function"||!Symbol.iterator?"@@iterator":Symbol.iterator}var er=Gi();function tr(e){return k(e==null?void 0:e[er])}function rr(e){return lo(this,arguments,function(){var r,o,n,i;return Nt(this,function(a){switch(a.label){case 0:r=e.getReader(),a.label=1;case 1:a.trys.push([1,,9,10]),a.label=2;case 2:return[4,nt(r.read())];case 3:return o=a.sent(),n=o.value,i=o.done,i?[4,nt(void 0)]:[3,5];case 4:return[2,a.sent()];case 5:return[4,nt(n)];case 6:return[4,a.sent()];case 7:return a.sent(),[3,2];case 8:return[3,10];case 9:return r.releaseLock(),[7];case 10:return[2]}})})}function or(e){return k(e==null?void 0:e.getReader)}function W(e){if(e instanceof F)return e;if(e!=null){if(Jt(e))return Ji(e);if(xt(e))return Xi(e);if(Gt(e))return Zi(e);if(Xt(e))return Lo(e);if(tr(e))return ea(e);if(or(e))return ta(e)}throw Zt(e)}function Ji(e){return new F(function(t){var r=e[ht]();if(k(r.subscribe))return r.subscribe(t);throw new TypeError("Provided object does not correctly implement Symbol.observable")})}function Xi(e){return new F(function(t){for(var r=0;r=2;return function(o){return o.pipe(e?b(function(n,i){return e(n,i,o)}):le,Te(1),r?Be(t):zo(function(){return new ir}))}}function Fr(e){return e<=0?function(){return O}:y(function(t,r){var o=[];t.subscribe(T(r,function(n){o.push(n),e=2,!0))}function pe(e){e===void 0&&(e={});var t=e.connector,r=t===void 0?function(){return new g}:t,o=e.resetOnError,n=o===void 0?!0:o,i=e.resetOnComplete,a=i===void 0?!0:i,s=e.resetOnRefCountZero,p=s===void 0?!0:s;return function(c){var l,f,u,h=0,w=!1,A=!1,te=function(){f==null||f.unsubscribe(),f=void 0},ie=function(){te(),l=u=void 0,w=A=!1},J=function(){var H=l;ie(),H==null||H.unsubscribe()};return y(function(H,mt){h++,!A&&!w&&te();var ze=u=u!=null?u:r();mt.add(function(){h--,h===0&&!A&&!w&&(f=Wr(J,p))}),ze.subscribe(mt),!l&&h>0&&(l=new at({next:function(Ie){return ze.next(Ie)},error:function(Ie){A=!0,te(),f=Wr(ie,n,Ie),ze.error(Ie)},complete:function(){w=!0,te(),f=Wr(ie,a),ze.complete()}}),W(H).subscribe(l))})(c)}}function Wr(e,t){for(var r=[],o=2;oe.next(document)),e}function $(e,t=document){return Array.from(t.querySelectorAll(e))}function P(e,t=document){let r=fe(e,t);if(typeof r=="undefined")throw new ReferenceError(`Missing element: expected "${e}" to be present`);return r}function fe(e,t=document){return t.querySelector(e)||void 0}function Re(){var e,t,r,o;return(o=(r=(t=(e=document.activeElement)==null?void 0:e.shadowRoot)==null?void 0:t.activeElement)!=null?r:document.activeElement)!=null?o:void 0}var xa=S(d(document.body,"focusin"),d(document.body,"focusout")).pipe(_e(1),Q(void 0),m(()=>Re()||document.body),G(1));function et(e){return xa.pipe(m(t=>e.contains(t)),K())}function kt(e,t){return C(()=>S(d(e,"mouseenter").pipe(m(()=>!0)),d(e,"mouseleave").pipe(m(()=>!1))).pipe(t?Ht(r=>Me(+!r*t)):le,Q(e.matches(":hover"))))}function Bo(e,t){if(typeof t=="string"||typeof t=="number")e.innerHTML+=t.toString();else if(t instanceof Node)e.appendChild(t);else if(Array.isArray(t))for(let r of t)Bo(e,r)}function x(e,t,...r){let o=document.createElement(e);if(t)for(let n of Object.keys(t))typeof t[n]!="undefined"&&(typeof t[n]!="boolean"?o.setAttribute(n,t[n]):o.setAttribute(n,""));for(let n of r)Bo(o,n);return o}function sr(e){if(e>999){let t=+((e-950)%1e3>99);return`${((e+1e-6)/1e3).toFixed(t)}k`}else return e.toString()}function wt(e){let t=x("script",{src:e});return C(()=>(document.head.appendChild(t),S(d(t,"load"),d(t,"error").pipe(v(()=>$r(()=>new ReferenceError(`Invalid script: ${e}`))))).pipe(m(()=>{}),L(()=>document.head.removeChild(t)),Te(1))))}var Go=new g,ya=C(()=>typeof ResizeObserver=="undefined"?wt("https://unpkg.com/resize-observer-polyfill"):I(void 0)).pipe(m(()=>new ResizeObserver(e=>e.forEach(t=>Go.next(t)))),v(e=>S(Ke,I(e)).pipe(L(()=>e.disconnect()))),G(1));function ce(e){return{width:e.offsetWidth,height:e.offsetHeight}}function ge(e){let t=e;for(;t.clientWidth===0&&t.parentElement;)t=t.parentElement;return ya.pipe(E(r=>r.observe(t)),v(r=>Go.pipe(b(o=>o.target===t),L(()=>r.unobserve(t)))),m(()=>ce(e)),Q(ce(e)))}function Tt(e){return{width:e.scrollWidth,height:e.scrollHeight}}function cr(e){let t=e.parentElement;for(;t&&(e.scrollWidth<=t.scrollWidth&&e.scrollHeight<=t.scrollHeight);)t=(e=t).parentElement;return t?e:void 0}function Jo(e){let t=[],r=e.parentElement;for(;r;)(e.clientWidth>r.clientWidth||e.clientHeight>r.clientHeight)&&t.push(r),r=(e=r).parentElement;return t.length===0&&t.push(document.documentElement),t}function Ue(e){return{x:e.offsetLeft,y:e.offsetTop}}function Xo(e){let t=e.getBoundingClientRect();return{x:t.x+window.scrollX,y:t.y+window.scrollY}}function Zo(e){return S(d(window,"load"),d(window,"resize")).pipe(Le(0,me),m(()=>Ue(e)),Q(Ue(e)))}function pr(e){return{x:e.scrollLeft,y:e.scrollTop}}function De(e){return S(d(e,"scroll"),d(window,"scroll"),d(window,"resize")).pipe(Le(0,me),m(()=>pr(e)),Q(pr(e)))}var en=new g,Ea=C(()=>I(new IntersectionObserver(e=>{for(let t of e)en.next(t)},{threshold:0}))).pipe(v(e=>S(Ke,I(e)).pipe(L(()=>e.disconnect()))),G(1));function tt(e){return Ea.pipe(E(t=>t.observe(e)),v(t=>en.pipe(b(({target:r})=>r===e),L(()=>t.unobserve(e)),m(({isIntersecting:r})=>r))))}function tn(e,t=16){return De(e).pipe(m(({y:r})=>{let o=ce(e),n=Tt(e);return r>=n.height-o.height-t}),K())}var lr={drawer:P("[data-md-toggle=drawer]"),search:P("[data-md-toggle=search]")};function rn(e){return lr[e].checked}function Je(e,t){lr[e].checked!==t&&lr[e].click()}function Ve(e){let t=lr[e];return d(t,"change").pipe(m(()=>t.checked),Q(t.checked))}function wa(e,t){switch(e.constructor){case HTMLInputElement:return e.type==="radio"?/^Arrow/.test(t):!0;case HTMLSelectElement:case HTMLTextAreaElement:return!0;default:return e.isContentEditable}}function Ta(){return S(d(window,"compositionstart").pipe(m(()=>!0)),d(window,"compositionend").pipe(m(()=>!1))).pipe(Q(!1))}function on(){let e=d(window,"keydown").pipe(b(t=>!(t.metaKey||t.ctrlKey)),m(t=>({mode:rn("search")?"search":"global",type:t.key,claim(){t.preventDefault(),t.stopPropagation()}})),b(({mode:t,type:r})=>{if(t==="global"){let o=Re();if(typeof o!="undefined")return!wa(o,r)}return!0}),pe());return Ta().pipe(v(t=>t?O:e))}function xe(){return new URL(location.href)}function pt(e,t=!1){if(B("navigation.instant")&&!t){let r=x("a",{href:e.href});document.body.appendChild(r),r.click(),r.remove()}else location.href=e.href}function nn(){return new g}function an(){return location.hash.slice(1)}function sn(e){let t=x("a",{href:e});t.addEventListener("click",r=>r.stopPropagation()),t.click()}function Sa(e){return S(d(window,"hashchange"),e).pipe(m(an),Q(an()),b(t=>t.length>0),G(1))}function cn(e){return Sa(e).pipe(m(t=>fe(`[id="${t}"]`)),b(t=>typeof t!="undefined"))}function $t(e){let t=matchMedia(e);return ar(r=>t.addListener(()=>r(t.matches))).pipe(Q(t.matches))}function pn(){let e=matchMedia("print");return S(d(window,"beforeprint").pipe(m(()=>!0)),d(window,"afterprint").pipe(m(()=>!1))).pipe(Q(e.matches))}function Nr(e,t){return e.pipe(v(r=>r?t():O))}function zr(e,t){return new F(r=>{let o=new XMLHttpRequest;return o.open("GET",`${e}`),o.responseType="blob",o.addEventListener("load",()=>{o.status>=200&&o.status<300?(r.next(o.response),r.complete()):r.error(new Error(o.statusText))}),o.addEventListener("error",()=>{r.error(new Error("Network error"))}),o.addEventListener("abort",()=>{r.complete()}),typeof(t==null?void 0:t.progress$)!="undefined"&&(o.addEventListener("progress",n=>{var i;if(n.lengthComputable)t.progress$.next(n.loaded/n.total*100);else{let a=(i=o.getResponseHeader("Content-Length"))!=null?i:0;t.progress$.next(n.loaded/+a*100)}}),t.progress$.next(5)),o.send(),()=>o.abort()})}function Ne(e,t){return zr(e,t).pipe(v(r=>r.text()),m(r=>JSON.parse(r)),G(1))}function ln(e,t){let r=new DOMParser;return zr(e,t).pipe(v(o=>o.text()),m(o=>r.parseFromString(o,"text/html")),G(1))}function mn(e,t){let r=new DOMParser;return zr(e,t).pipe(v(o=>o.text()),m(o=>r.parseFromString(o,"text/xml")),G(1))}function fn(){return{x:Math.max(0,scrollX),y:Math.max(0,scrollY)}}function un(){return S(d(window,"scroll",{passive:!0}),d(window,"resize",{passive:!0})).pipe(m(fn),Q(fn()))}function dn(){return{width:innerWidth,height:innerHeight}}function hn(){return d(window,"resize",{passive:!0}).pipe(m(dn),Q(dn()))}function bn(){return z([un(),hn()]).pipe(m(([e,t])=>({offset:e,size:t})),G(1))}function mr(e,{viewport$:t,header$:r}){let o=t.pipe(Z("size")),n=z([o,r]).pipe(m(()=>Ue(e)));return z([r,t,n]).pipe(m(([{height:i},{offset:a,size:s},{x:p,y:c}])=>({offset:{x:a.x-p,y:a.y-c+i},size:s})))}function Oa(e){return d(e,"message",t=>t.data)}function Ma(e){let t=new g;return t.subscribe(r=>e.postMessage(r)),t}function vn(e,t=new Worker(e)){let r=Oa(t),o=Ma(t),n=new g;n.subscribe(o);let i=o.pipe(X(),ne(!0));return n.pipe(X(),Pe(r.pipe(U(i))),pe())}var La=P("#__config"),St=JSON.parse(La.textContent);St.base=`${new URL(St.base,xe())}`;function ye(){return St}function B(e){return St.features.includes(e)}function Ee(e,t){return typeof t!="undefined"?St.translations[e].replace("#",t.toString()):St.translations[e]}function Se(e,t=document){return P(`[data-md-component=${e}]`,t)}function ae(e,t=document){return $(`[data-md-component=${e}]`,t)}function _a(e){let t=P(".md-typeset > :first-child",e);return d(t,"click",{once:!0}).pipe(m(()=>P(".md-typeset",e)),m(r=>({hash:__md_hash(r.innerHTML)})))}function gn(e){if(!B("announce.dismiss")||!e.childElementCount)return O;if(!e.hidden){let t=P(".md-typeset",e);__md_hash(t.innerHTML)===__md_get("__announce")&&(e.hidden=!0)}return C(()=>{let t=new g;return t.subscribe(({hash:r})=>{e.hidden=!0,__md_set("__announce",r)}),_a(e).pipe(E(r=>t.next(r)),L(()=>t.complete()),m(r=>R({ref:e},r)))})}function Aa(e,{target$:t}){return t.pipe(m(r=>({hidden:r!==e})))}function xn(e,t){let r=new g;return r.subscribe(({hidden:o})=>{e.hidden=o}),Aa(e,t).pipe(E(o=>r.next(o)),L(()=>r.complete()),m(o=>R({ref:e},o)))}function Pt(e,t){return t==="inline"?x("div",{class:"md-tooltip md-tooltip--inline",id:e,role:"tooltip"},x("div",{class:"md-tooltip__inner md-typeset"})):x("div",{class:"md-tooltip",id:e,role:"tooltip"},x("div",{class:"md-tooltip__inner md-typeset"}))}function yn(...e){return x("div",{class:"md-tooltip2",role:"tooltip"},x("div",{class:"md-tooltip2__inner md-typeset"},e))}function En(e,t){if(t=t?`${t}_annotation_${e}`:void 0,t){let r=t?`#${t}`:void 0;return x("aside",{class:"md-annotation",tabIndex:0},Pt(t),x("a",{href:r,class:"md-annotation__index",tabIndex:-1},x("span",{"data-md-annotation-id":e})))}else return x("aside",{class:"md-annotation",tabIndex:0},Pt(t),x("span",{class:"md-annotation__index",tabIndex:-1},x("span",{"data-md-annotation-id":e})))}function wn(e){return x("button",{class:"md-clipboard md-icon",title:Ee("clipboard.copy"),"data-clipboard-target":`#${e} > code`})}function qr(e,t){let r=t&2,o=t&1,n=Object.keys(e.terms).filter(p=>!e.terms[p]).reduce((p,c)=>[...p,x("del",null,c)," "],[]).slice(0,-1),i=ye(),a=new URL(e.location,i.base);B("search.highlight")&&a.searchParams.set("h",Object.entries(e.terms).filter(([,p])=>p).reduce((p,[c])=>`${p} ${c}`.trim(),""));let{tags:s}=ye();return x("a",{href:`${a}`,class:"md-search-result__link",tabIndex:-1},x("article",{class:"md-search-result__article md-typeset","data-md-score":e.score.toFixed(2)},r>0&&x("div",{class:"md-search-result__icon md-icon"}),r>0&&x("h1",null,e.title),r<=0&&x("h2",null,e.title),o>0&&e.text.length>0&&e.text,e.tags&&e.tags.map(p=>{let c=s?p in s?`md-tag-icon md-tag--${s[p]}`:"md-tag-icon":"";return x("span",{class:`md-tag ${c}`},p)}),o>0&&n.length>0&&x("p",{class:"md-search-result__terms"},Ee("search.result.term.missing"),": ",...n)))}function Tn(e){let t=e[0].score,r=[...e],o=ye(),n=r.findIndex(l=>!`${new URL(l.location,o.base)}`.includes("#")),[i]=r.splice(n,1),a=r.findIndex(l=>l.scoreqr(l,1)),...p.length?[x("details",{class:"md-search-result__more"},x("summary",{tabIndex:-1},x("div",null,p.length>0&&p.length===1?Ee("search.result.more.one"):Ee("search.result.more.other",p.length))),...p.map(l=>qr(l,1)))]:[]];return x("li",{class:"md-search-result__item"},c)}function Sn(e){return x("ul",{class:"md-source__facts"},Object.entries(e).map(([t,r])=>x("li",{class:`md-source__fact md-source__fact--${t}`},typeof r=="number"?sr(r):r)))}function Qr(e){let t=`tabbed-control tabbed-control--${e}`;return x("div",{class:t,hidden:!0},x("button",{class:"tabbed-button",tabIndex:-1,"aria-hidden":"true"}))}function On(e){return x("div",{class:"md-typeset__scrollwrap"},x("div",{class:"md-typeset__table"},e))}function Ca(e){var o;let t=ye(),r=new URL(`../${e.version}/`,t.base);return x("li",{class:"md-version__item"},x("a",{href:`${r}`,class:"md-version__link"},e.title,((o=t.version)==null?void 0:o.alias)&&e.aliases.length>0&&x("span",{class:"md-version__alias"},e.aliases[0])))}function Mn(e,t){var o;let r=ye();return e=e.filter(n=>{var i;return!((i=n.properties)!=null&&i.hidden)}),x("div",{class:"md-version"},x("button",{class:"md-version__current","aria-label":Ee("select.version")},t.title,((o=r.version)==null?void 0:o.alias)&&t.aliases.length>0&&x("span",{class:"md-version__alias"},t.aliases[0])),x("ul",{class:"md-version__list"},e.map(Ca)))}var Ha=0;function ka(e){let t=z([et(e),kt(e)]).pipe(m(([o,n])=>o||n),K()),r=C(()=>Jo(e)).pipe(oe(De),ct(1),m(()=>Xo(e)));return t.pipe(Ae(o=>o),v(()=>z([t,r])),m(([o,n])=>({active:o,offset:n})),pe())}function $a(e,t){let{content$:r,viewport$:o}=t,n=`__tooltip2_${Ha++}`;return C(()=>{let i=new g,a=new _r(!1);i.pipe(X(),ne(!1)).subscribe(a);let s=a.pipe(Ht(c=>Me(+!c*250,Hr)),K(),v(c=>c?r:O),E(c=>c.id=n),pe());z([i.pipe(m(({active:c})=>c)),s.pipe(v(c=>kt(c,250)),Q(!1))]).pipe(m(c=>c.some(l=>l))).subscribe(a);let p=a.pipe(b(c=>c),ee(s,o),m(([c,l,{size:f}])=>{let u=e.getBoundingClientRect(),h=u.width/2;if(l.role==="tooltip")return{x:h,y:8+u.height};if(u.y>=f.height/2){let{height:w}=ce(l);return{x:h,y:-16-w}}else return{x:h,y:16+u.height}}));return z([s,i,p]).subscribe(([c,{offset:l},f])=>{c.style.setProperty("--md-tooltip-host-x",`${l.x}px`),c.style.setProperty("--md-tooltip-host-y",`${l.y}px`),c.style.setProperty("--md-tooltip-x",`${f.x}px`),c.style.setProperty("--md-tooltip-y",`${f.y}px`),c.classList.toggle("md-tooltip2--top",f.y<0),c.classList.toggle("md-tooltip2--bottom",f.y>=0)}),a.pipe(b(c=>c),ee(s,(c,l)=>l),b(c=>c.role==="tooltip")).subscribe(c=>{let l=ce(P(":scope > *",c));c.style.setProperty("--md-tooltip-width",`${l.width}px`),c.style.setProperty("--md-tooltip-tail","0px")}),a.pipe(K(),be(me),ee(s)).subscribe(([c,l])=>{l.classList.toggle("md-tooltip2--active",c)}),z([a.pipe(b(c=>c)),s]).subscribe(([c,l])=>{l.role==="dialog"?(e.setAttribute("aria-controls",n),e.setAttribute("aria-haspopup","dialog")):e.setAttribute("aria-describedby",n)}),a.pipe(b(c=>!c)).subscribe(()=>{e.removeAttribute("aria-controls"),e.removeAttribute("aria-describedby"),e.removeAttribute("aria-haspopup")}),ka(e).pipe(E(c=>i.next(c)),L(()=>i.complete()),m(c=>R({ref:e},c)))})}function lt(e,{viewport$:t},r=document.body){return $a(e,{content$:new F(o=>{let n=e.title,i=yn(n);return o.next(i),e.removeAttribute("title"),r.append(i),()=>{i.remove(),e.setAttribute("title",n)}}),viewport$:t})}function Pa(e,t){let r=C(()=>z([Zo(e),De(t)])).pipe(m(([{x:o,y:n},i])=>{let{width:a,height:s}=ce(e);return{x:o-i.x+a/2,y:n-i.y+s/2}}));return et(e).pipe(v(o=>r.pipe(m(n=>({active:o,offset:n})),Te(+!o||1/0))))}function Ln(e,t,{target$:r}){let[o,n]=Array.from(e.children);return C(()=>{let i=new g,a=i.pipe(X(),ne(!0));return i.subscribe({next({offset:s}){e.style.setProperty("--md-tooltip-x",`${s.x}px`),e.style.setProperty("--md-tooltip-y",`${s.y}px`)},complete(){e.style.removeProperty("--md-tooltip-x"),e.style.removeProperty("--md-tooltip-y")}}),tt(e).pipe(U(a)).subscribe(s=>{e.toggleAttribute("data-md-visible",s)}),S(i.pipe(b(({active:s})=>s)),i.pipe(_e(250),b(({active:s})=>!s))).subscribe({next({active:s}){s?e.prepend(o):o.remove()},complete(){e.prepend(o)}}),i.pipe(Le(16,me)).subscribe(({active:s})=>{o.classList.toggle("md-tooltip--active",s)}),i.pipe(ct(125,me),b(()=>!!e.offsetParent),m(()=>e.offsetParent.getBoundingClientRect()),m(({x:s})=>s)).subscribe({next(s){s?e.style.setProperty("--md-tooltip-0",`${-s}px`):e.style.removeProperty("--md-tooltip-0")},complete(){e.style.removeProperty("--md-tooltip-0")}}),d(n,"click").pipe(U(a),b(s=>!(s.metaKey||s.ctrlKey))).subscribe(s=>{s.stopPropagation(),s.preventDefault()}),d(n,"mousedown").pipe(U(a),ee(i)).subscribe(([s,{active:p}])=>{var c;if(s.button!==0||s.metaKey||s.ctrlKey)s.preventDefault();else if(p){s.preventDefault();let l=e.parentElement.closest(".md-annotation");l instanceof HTMLElement?l.focus():(c=Re())==null||c.blur()}}),r.pipe(U(a),b(s=>s===o),Ge(125)).subscribe(()=>e.focus()),Pa(e,t).pipe(E(s=>i.next(s)),L(()=>i.complete()),m(s=>R({ref:e},s)))})}function Ra(e){return e.tagName==="CODE"?$(".c, .c1, .cm",e):[e]}function Ia(e){let t=[];for(let r of Ra(e)){let o=[],n=document.createNodeIterator(r,NodeFilter.SHOW_TEXT);for(let i=n.nextNode();i;i=n.nextNode())o.push(i);for(let i of o){let a;for(;a=/(\(\d+\))(!)?/.exec(i.textContent);){let[,s,p]=a;if(typeof p=="undefined"){let c=i.splitText(a.index);i=c.splitText(s.length),t.push(c)}else{i.textContent=s,t.push(i);break}}}}return t}function _n(e,t){t.append(...Array.from(e.childNodes))}function fr(e,t,{target$:r,print$:o}){let n=t.closest("[id]"),i=n==null?void 0:n.id,a=new Map;for(let s of Ia(t)){let[,p]=s.textContent.match(/\((\d+)\)/);fe(`:scope > li:nth-child(${p})`,e)&&(a.set(p,En(p,i)),s.replaceWith(a.get(p)))}return a.size===0?O:C(()=>{let s=new g,p=s.pipe(X(),ne(!0)),c=[];for(let[l,f]of a)c.push([P(".md-typeset",f),P(`:scope > li:nth-child(${l})`,e)]);return o.pipe(U(p)).subscribe(l=>{e.hidden=!l,e.classList.toggle("md-annotation-list",l);for(let[f,u]of c)l?_n(f,u):_n(u,f)}),S(...[...a].map(([,l])=>Ln(l,t,{target$:r}))).pipe(L(()=>s.complete()),pe())})}function An(e){if(e.nextElementSibling){let t=e.nextElementSibling;if(t.tagName==="OL")return t;if(t.tagName==="P"&&!t.children.length)return An(t)}}function Cn(e,t){return C(()=>{let r=An(e);return typeof r!="undefined"?fr(r,e,t):O})}var Hn=Vt(Yr());var Fa=0;function kn(e){if(e.nextElementSibling){let t=e.nextElementSibling;if(t.tagName==="OL")return t;if(t.tagName==="P"&&!t.children.length)return kn(t)}}function ja(e){return ge(e).pipe(m(({width:t})=>({scrollable:Tt(e).width>t})),Z("scrollable"))}function $n(e,t){let{matches:r}=matchMedia("(hover)"),o=C(()=>{let n=new g,i=n.pipe(Fr(1));n.subscribe(({scrollable:c})=>{c&&r?e.setAttribute("tabindex","0"):e.removeAttribute("tabindex")});let a=[];if(Hn.default.isSupported()&&(e.closest(".copy")||B("content.code.copy")&&!e.closest(".no-copy"))){let c=e.closest("pre");c.id=`__code_${Fa++}`;let l=wn(c.id);c.insertBefore(l,e),B("content.tooltips")&&a.push(lt(l,{viewport$}))}let s=e.closest(".highlight");if(s instanceof HTMLElement){let c=kn(s);if(typeof c!="undefined"&&(s.classList.contains("annotate")||B("content.code.annotate"))){let l=fr(c,e,t);a.push(ge(s).pipe(U(i),m(({width:f,height:u})=>f&&u),K(),v(f=>f?l:O)))}}return $(":scope > span[id]",e).length&&e.classList.add("md-code__content"),ja(e).pipe(E(c=>n.next(c)),L(()=>n.complete()),m(c=>R({ref:e},c)),Pe(...a))});return B("content.lazy")?tt(e).pipe(b(n=>n),Te(1),v(()=>o)):o}function Wa(e,{target$:t,print$:r}){let o=!0;return S(t.pipe(m(n=>n.closest("details:not([open])")),b(n=>e===n),m(()=>({action:"open",reveal:!0}))),r.pipe(b(n=>n||!o),E(()=>o=e.open),m(n=>({action:n?"open":"close"}))))}function Pn(e,t){return C(()=>{let r=new g;return r.subscribe(({action:o,reveal:n})=>{e.toggleAttribute("open",o==="open"),n&&e.scrollIntoView()}),Wa(e,t).pipe(E(o=>r.next(o)),L(()=>r.complete()),m(o=>R({ref:e},o)))})}var Rn=".node circle,.node ellipse,.node path,.node polygon,.node rect{fill:var(--md-mermaid-node-bg-color);stroke:var(--md-mermaid-node-fg-color)}marker{fill:var(--md-mermaid-edge-color)!important}.edgeLabel .label rect{fill:#0000}.label{color:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}.label foreignObject{line-height:normal;overflow:visible}.label div .edgeLabel{color:var(--md-mermaid-label-fg-color)}.edgeLabel,.edgeLabel rect,.label div .edgeLabel{background-color:var(--md-mermaid-label-bg-color)}.edgeLabel,.edgeLabel rect{fill:var(--md-mermaid-label-bg-color);color:var(--md-mermaid-edge-color)}.edgePath .path,.flowchart-link{stroke:var(--md-mermaid-edge-color);stroke-width:.05rem}.edgePath .arrowheadPath{fill:var(--md-mermaid-edge-color);stroke:none}.cluster rect{fill:var(--md-default-fg-color--lightest);stroke:var(--md-default-fg-color--lighter)}.cluster span{color:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}g #flowchart-circleEnd,g #flowchart-circleStart,g #flowchart-crossEnd,g #flowchart-crossStart,g #flowchart-pointEnd,g #flowchart-pointStart{stroke:none}g.classGroup line,g.classGroup rect{fill:var(--md-mermaid-node-bg-color);stroke:var(--md-mermaid-node-fg-color)}g.classGroup text{fill:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}.classLabel .box{fill:var(--md-mermaid-label-bg-color);background-color:var(--md-mermaid-label-bg-color);opacity:1}.classLabel .label{fill:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}.node .divider{stroke:var(--md-mermaid-node-fg-color)}.relation{stroke:var(--md-mermaid-edge-color)}.cardinality{fill:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}.cardinality text{fill:inherit!important}defs #classDiagram-compositionEnd,defs #classDiagram-compositionStart,defs #classDiagram-dependencyEnd,defs #classDiagram-dependencyStart,defs #classDiagram-extensionEnd,defs #classDiagram-extensionStart{fill:var(--md-mermaid-edge-color)!important;stroke:var(--md-mermaid-edge-color)!important}defs #classDiagram-aggregationEnd,defs #classDiagram-aggregationStart{fill:var(--md-mermaid-label-bg-color)!important;stroke:var(--md-mermaid-edge-color)!important}g.stateGroup rect{fill:var(--md-mermaid-node-bg-color);stroke:var(--md-mermaid-node-fg-color)}g.stateGroup .state-title{fill:var(--md-mermaid-label-fg-color)!important;font-family:var(--md-mermaid-font-family)}g.stateGroup .composit{fill:var(--md-mermaid-label-bg-color)}.nodeLabel,.nodeLabel p{color:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}a .nodeLabel{text-decoration:underline}.node circle.state-end,.node circle.state-start,.start-state{fill:var(--md-mermaid-edge-color);stroke:none}.end-state-inner,.end-state-outer{fill:var(--md-mermaid-edge-color)}.end-state-inner,.node circle.state-end{stroke:var(--md-mermaid-label-bg-color)}.transition{stroke:var(--md-mermaid-edge-color)}[id^=state-fork] rect,[id^=state-join] rect{fill:var(--md-mermaid-edge-color)!important;stroke:none!important}.statediagram-cluster.statediagram-cluster .inner{fill:var(--md-default-bg-color)}.statediagram-cluster rect{fill:var(--md-mermaid-node-bg-color);stroke:var(--md-mermaid-node-fg-color)}.statediagram-state rect.divider{fill:var(--md-default-fg-color--lightest);stroke:var(--md-default-fg-color--lighter)}defs #statediagram-barbEnd{stroke:var(--md-mermaid-edge-color)}.attributeBoxEven,.attributeBoxOdd{fill:var(--md-mermaid-node-bg-color);stroke:var(--md-mermaid-node-fg-color)}.entityBox{fill:var(--md-mermaid-label-bg-color);stroke:var(--md-mermaid-node-fg-color)}.entityLabel{fill:var(--md-mermaid-label-fg-color);font-family:var(--md-mermaid-font-family)}.relationshipLabelBox{fill:var(--md-mermaid-label-bg-color);fill-opacity:1;background-color:var(--md-mermaid-label-bg-color);opacity:1}.relationshipLabel{fill:var(--md-mermaid-label-fg-color)}.relationshipLine{stroke:var(--md-mermaid-edge-color)}defs #ONE_OR_MORE_END *,defs #ONE_OR_MORE_START *,defs #ONLY_ONE_END *,defs #ONLY_ONE_START *,defs #ZERO_OR_MORE_END *,defs #ZERO_OR_MORE_START *,defs #ZERO_OR_ONE_END *,defs #ZERO_OR_ONE_START *{stroke:var(--md-mermaid-edge-color)!important}defs #ZERO_OR_MORE_END circle,defs #ZERO_OR_MORE_START circle{fill:var(--md-mermaid-label-bg-color)}.actor{fill:var(--md-mermaid-sequence-actor-bg-color);stroke:var(--md-mermaid-sequence-actor-border-color)}text.actor>tspan{fill:var(--md-mermaid-sequence-actor-fg-color);font-family:var(--md-mermaid-font-family)}line{stroke:var(--md-mermaid-sequence-actor-line-color)}.actor-man circle,.actor-man line{fill:var(--md-mermaid-sequence-actorman-bg-color);stroke:var(--md-mermaid-sequence-actorman-line-color)}.messageLine0,.messageLine1{stroke:var(--md-mermaid-sequence-message-line-color)}.note{fill:var(--md-mermaid-sequence-note-bg-color);stroke:var(--md-mermaid-sequence-note-border-color)}.loopText,.loopText>tspan,.messageText,.noteText>tspan{stroke:none;font-family:var(--md-mermaid-font-family)!important}.messageText{fill:var(--md-mermaid-sequence-message-fg-color)}.loopText,.loopText>tspan{fill:var(--md-mermaid-sequence-loop-fg-color)}.noteText>tspan{fill:var(--md-mermaid-sequence-note-fg-color)}#arrowhead path{fill:var(--md-mermaid-sequence-message-line-color);stroke:none}.loopLine{fill:var(--md-mermaid-sequence-loop-bg-color);stroke:var(--md-mermaid-sequence-loop-border-color)}.labelBox{fill:var(--md-mermaid-sequence-label-bg-color);stroke:none}.labelText,.labelText>span{fill:var(--md-mermaid-sequence-label-fg-color);font-family:var(--md-mermaid-font-family)}.sequenceNumber{fill:var(--md-mermaid-sequence-number-fg-color)}rect.rect{fill:var(--md-mermaid-sequence-box-bg-color);stroke:none}rect.rect+text.text{fill:var(--md-mermaid-sequence-box-fg-color)}defs #sequencenumber{fill:var(--md-mermaid-sequence-number-bg-color)!important}";var Br,Da=0;function Va(){return typeof mermaid=="undefined"||mermaid instanceof Element?wt("https://unpkg.com/mermaid@10/dist/mermaid.min.js"):I(void 0)}function In(e){return e.classList.remove("mermaid"),Br||(Br=Va().pipe(E(()=>mermaid.initialize({startOnLoad:!1,themeCSS:Rn,sequence:{actorFontSize:"16px",messageFontSize:"16px",noteFontSize:"16px"}})),m(()=>{}),G(1))),Br.subscribe(()=>ao(this,null,function*(){e.classList.add("mermaid");let t=`__mermaid_${Da++}`,r=x("div",{class:"mermaid"}),o=e.textContent,{svg:n,fn:i}=yield mermaid.render(t,o),a=r.attachShadow({mode:"closed"});a.innerHTML=n,e.replaceWith(r),i==null||i(a)})),Br.pipe(m(()=>({ref:e})))}var Fn=x("table");function jn(e){return e.replaceWith(Fn),Fn.replaceWith(On(e)),I({ref:e})}function Na(e){let t=e.find(r=>r.checked)||e[0];return S(...e.map(r=>d(r,"change").pipe(m(()=>P(`label[for="${r.id}"]`))))).pipe(Q(P(`label[for="${t.id}"]`)),m(r=>({active:r})))}function Wn(e,{viewport$:t,target$:r}){let o=P(".tabbed-labels",e),n=$(":scope > input",e),i=Qr("prev");e.append(i);let a=Qr("next");return e.append(a),C(()=>{let s=new g,p=s.pipe(X(),ne(!0));z([s,ge(e),tt(e)]).pipe(U(p),Le(1,me)).subscribe({next([{active:c},l]){let f=Ue(c),{width:u}=ce(c);e.style.setProperty("--md-indicator-x",`${f.x}px`),e.style.setProperty("--md-indicator-width",`${u}px`);let h=pr(o);(f.xh.x+l.width)&&o.scrollTo({left:Math.max(0,f.x-16),behavior:"smooth"})},complete(){e.style.removeProperty("--md-indicator-x"),e.style.removeProperty("--md-indicator-width")}}),z([De(o),ge(o)]).pipe(U(p)).subscribe(([c,l])=>{let f=Tt(o);i.hidden=c.x<16,a.hidden=c.x>f.width-l.width-16}),S(d(i,"click").pipe(m(()=>-1)),d(a,"click").pipe(m(()=>1))).pipe(U(p)).subscribe(c=>{let{width:l}=ce(o);o.scrollBy({left:l*c,behavior:"smooth"})}),r.pipe(U(p),b(c=>n.includes(c))).subscribe(c=>c.click()),o.classList.add("tabbed-labels--linked");for(let c of n){let l=P(`label[for="${c.id}"]`);l.replaceChildren(x("a",{href:`#${l.htmlFor}`,tabIndex:-1},...Array.from(l.childNodes))),d(l.firstElementChild,"click").pipe(U(p),b(f=>!(f.metaKey||f.ctrlKey)),E(f=>{f.preventDefault(),f.stopPropagation()})).subscribe(()=>{history.replaceState({},"",`#${l.htmlFor}`),l.click()})}return B("content.tabs.link")&&s.pipe(Ce(1),ee(t)).subscribe(([{active:c},{offset:l}])=>{let f=c.innerText.trim();if(c.hasAttribute("data-md-switching"))c.removeAttribute("data-md-switching");else{let u=e.offsetTop-l.y;for(let w of $("[data-tabs]"))for(let A of $(":scope > input",w)){let te=P(`label[for="${A.id}"]`);if(te!==c&&te.innerText.trim()===f){te.setAttribute("data-md-switching",""),A.click();break}}window.scrollTo({top:e.offsetTop-u});let h=__md_get("__tabs")||[];__md_set("__tabs",[...new Set([f,...h])])}}),s.pipe(U(p)).subscribe(()=>{for(let c of $("audio, video",e))c.pause()}),Na(n).pipe(E(c=>s.next(c)),L(()=>s.complete()),m(c=>R({ref:e},c)))}).pipe(Qe(se))}function Un(e,{viewport$:t,target$:r,print$:o}){return S(...$(".annotate:not(.highlight)",e).map(n=>Cn(n,{target$:r,print$:o})),...$("pre:not(.mermaid) > code",e).map(n=>$n(n,{target$:r,print$:o})),...$("pre.mermaid",e).map(n=>In(n)),...$("table:not([class])",e).map(n=>jn(n)),...$("details",e).map(n=>Pn(n,{target$:r,print$:o})),...$("[data-tabs]",e).map(n=>Wn(n,{viewport$:t,target$:r})),...$("[title]",e).filter(()=>B("content.tooltips")).map(n=>lt(n,{viewport$:t})))}function za(e,{alert$:t}){return t.pipe(v(r=>S(I(!0),I(!1).pipe(Ge(2e3))).pipe(m(o=>({message:r,active:o})))))}function Dn(e,t){let r=P(".md-typeset",e);return C(()=>{let o=new g;return o.subscribe(({message:n,active:i})=>{e.classList.toggle("md-dialog--active",i),r.textContent=n}),za(e,t).pipe(E(n=>o.next(n)),L(()=>o.complete()),m(n=>R({ref:e},n)))})}var qa=0;function Qa(e,t){document.body.append(e);let{width:r}=ce(e);e.style.setProperty("--md-tooltip-width",`${r}px`),e.remove();let o=cr(t),n=typeof o!="undefined"?De(o):I({x:0,y:0}),i=S(et(t),kt(t)).pipe(K());return z([i,n]).pipe(m(([a,s])=>{let{x:p,y:c}=Ue(t),l=ce(t),f=t.closest("table");return f&&t.parentElement&&(p+=f.offsetLeft+t.parentElement.offsetLeft,c+=f.offsetTop+t.parentElement.offsetTop),{active:a,offset:{x:p-s.x+l.width/2-r/2,y:c-s.y+l.height+8}}}))}function Vn(e){let t=e.title;if(!t.length)return O;let r=`__tooltip_${qa++}`,o=Pt(r,"inline"),n=P(".md-typeset",o);return n.innerHTML=t,C(()=>{let i=new g;return i.subscribe({next({offset:a}){o.style.setProperty("--md-tooltip-x",`${a.x}px`),o.style.setProperty("--md-tooltip-y",`${a.y}px`)},complete(){o.style.removeProperty("--md-tooltip-x"),o.style.removeProperty("--md-tooltip-y")}}),S(i.pipe(b(({active:a})=>a)),i.pipe(_e(250),b(({active:a})=>!a))).subscribe({next({active:a}){a?(e.insertAdjacentElement("afterend",o),e.setAttribute("aria-describedby",r),e.removeAttribute("title")):(o.remove(),e.removeAttribute("aria-describedby"),e.setAttribute("title",t))},complete(){o.remove(),e.removeAttribute("aria-describedby"),e.setAttribute("title",t)}}),i.pipe(Le(16,me)).subscribe(({active:a})=>{o.classList.toggle("md-tooltip--active",a)}),i.pipe(ct(125,me),b(()=>!!e.offsetParent),m(()=>e.offsetParent.getBoundingClientRect()),m(({x:a})=>a)).subscribe({next(a){a?o.style.setProperty("--md-tooltip-0",`${-a}px`):o.style.removeProperty("--md-tooltip-0")},complete(){o.style.removeProperty("--md-tooltip-0")}}),Qa(o,e).pipe(E(a=>i.next(a)),L(()=>i.complete()),m(a=>R({ref:e},a)))}).pipe(Qe(se))}function Ka({viewport$:e}){if(!B("header.autohide"))return I(!1);let t=e.pipe(m(({offset:{y:n}})=>n),Ye(2,1),m(([n,i])=>[nMath.abs(i-n.y)>100),m(([,[n]])=>n),K()),o=Ve("search");return z([e,o]).pipe(m(([{offset:n},i])=>n.y>400&&!i),K(),v(n=>n?r:I(!1)),Q(!1))}function Nn(e,t){return C(()=>z([ge(e),Ka(t)])).pipe(m(([{height:r},o])=>({height:r,hidden:o})),K((r,o)=>r.height===o.height&&r.hidden===o.hidden),G(1))}function zn(e,{header$:t,main$:r}){return C(()=>{let o=new g,n=o.pipe(X(),ne(!0));o.pipe(Z("active"),We(t)).subscribe(([{active:a},{hidden:s}])=>{e.classList.toggle("md-header--shadow",a&&!s),e.hidden=s});let i=ue($("[title]",e)).pipe(b(()=>B("content.tooltips")),oe(a=>Vn(a)));return r.subscribe(o),t.pipe(U(n),m(a=>R({ref:e},a)),Pe(i.pipe(U(n))))})}function Ya(e,{viewport$:t,header$:r}){return mr(e,{viewport$:t,header$:r}).pipe(m(({offset:{y:o}})=>{let{height:n}=ce(e);return{active:o>=n}}),Z("active"))}function qn(e,t){return C(()=>{let r=new g;r.subscribe({next({active:n}){e.classList.toggle("md-header__title--active",n)},complete(){e.classList.remove("md-header__title--active")}});let o=fe(".md-content h1");return typeof o=="undefined"?O:Ya(o,t).pipe(E(n=>r.next(n)),L(()=>r.complete()),m(n=>R({ref:e},n)))})}function Qn(e,{viewport$:t,header$:r}){let o=r.pipe(m(({height:i})=>i),K()),n=o.pipe(v(()=>ge(e).pipe(m(({height:i})=>({top:e.offsetTop,bottom:e.offsetTop+i})),Z("bottom"))));return z([o,n,t]).pipe(m(([i,{top:a,bottom:s},{offset:{y:p},size:{height:c}}])=>(c=Math.max(0,c-Math.max(0,a-p,i)-Math.max(0,c+p-s)),{offset:a-i,height:c,active:a-i<=p})),K((i,a)=>i.offset===a.offset&&i.height===a.height&&i.active===a.active))}function Ba(e){let t=__md_get("__palette")||{index:e.findIndex(o=>matchMedia(o.getAttribute("data-md-color-media")).matches)},r=Math.max(0,Math.min(t.index,e.length-1));return I(...e).pipe(oe(o=>d(o,"change").pipe(m(()=>o))),Q(e[r]),m(o=>({index:e.indexOf(o),color:{media:o.getAttribute("data-md-color-media"),scheme:o.getAttribute("data-md-color-scheme"),primary:o.getAttribute("data-md-color-primary"),accent:o.getAttribute("data-md-color-accent")}})),G(1))}function Kn(e){let t=$("input",e),r=x("meta",{name:"theme-color"});document.head.appendChild(r);let o=x("meta",{name:"color-scheme"});document.head.appendChild(o);let n=$t("(prefers-color-scheme: light)");return C(()=>{let i=new g;return i.subscribe(a=>{if(document.body.setAttribute("data-md-color-switching",""),a.color.media==="(prefers-color-scheme)"){let s=matchMedia("(prefers-color-scheme: light)"),p=document.querySelector(s.matches?"[data-md-color-media='(prefers-color-scheme: light)']":"[data-md-color-media='(prefers-color-scheme: dark)']");a.color.scheme=p.getAttribute("data-md-color-scheme"),a.color.primary=p.getAttribute("data-md-color-primary"),a.color.accent=p.getAttribute("data-md-color-accent")}for(let[s,p]of Object.entries(a.color))document.body.setAttribute(`data-md-color-${s}`,p);for(let s=0;sa.key==="Enter"),ee(i,(a,s)=>s)).subscribe(({index:a})=>{a=(a+1)%t.length,t[a].click(),t[a].focus()}),i.pipe(m(()=>{let a=Se("header"),s=window.getComputedStyle(a);return o.content=s.colorScheme,s.backgroundColor.match(/\d+/g).map(p=>(+p).toString(16).padStart(2,"0")).join("")})).subscribe(a=>r.content=`#${a}`),i.pipe(be(se)).subscribe(()=>{document.body.removeAttribute("data-md-color-switching")}),Ba(t).pipe(U(n.pipe(Ce(1))),st(),E(a=>i.next(a)),L(()=>i.complete()),m(a=>R({ref:e},a)))})}function Yn(e,{progress$:t}){return C(()=>{let r=new g;return r.subscribe(({value:o})=>{e.style.setProperty("--md-progress-value",`${o}`)}),t.pipe(E(o=>r.next({value:o})),L(()=>r.complete()),m(o=>({ref:e,value:o})))})}var Gr=Vt(Yr());function Ga(e){e.setAttribute("data-md-copying","");let t=e.closest("[data-copy]"),r=t?t.getAttribute("data-copy"):e.innerText;return e.removeAttribute("data-md-copying"),r.trimEnd()}function Bn({alert$:e}){Gr.default.isSupported()&&new F(t=>{new Gr.default("[data-clipboard-target], [data-clipboard-text]",{text:r=>r.getAttribute("data-clipboard-text")||Ga(P(r.getAttribute("data-clipboard-target")))}).on("success",r=>t.next(r))}).pipe(E(t=>{t.trigger.focus()}),m(()=>Ee("clipboard.copied"))).subscribe(e)}function Gn(e,t){return e.protocol=t.protocol,e.hostname=t.hostname,e}function Ja(e,t){let r=new Map;for(let o of $("url",e)){let n=P("loc",o),i=[Gn(new URL(n.textContent),t)];r.set(`${i[0]}`,i);for(let a of $("[rel=alternate]",o)){let s=a.getAttribute("href");s!=null&&i.push(Gn(new URL(s),t))}}return r}function ur(e){return mn(new URL("sitemap.xml",e)).pipe(m(t=>Ja(t,new URL(e))),ve(()=>I(new Map)))}function Xa(e,t){if(!(e.target instanceof Element))return O;let r=e.target.closest("a");if(r===null)return O;if(r.target||e.metaKey||e.ctrlKey)return O;let o=new URL(r.href);return o.search=o.hash="",t.has(`${o}`)?(e.preventDefault(),I(new URL(r.href))):O}function Jn(e){let t=new Map;for(let r of $(":scope > *",e.head))t.set(r.outerHTML,r);return t}function Xn(e){for(let t of $("[href], [src]",e))for(let r of["href","src"]){let o=t.getAttribute(r);if(o&&!/^(?:[a-z]+:)?\/\//i.test(o)){t[r]=t[r];break}}return I(e)}function Za(e){for(let o of["[data-md-component=announce]","[data-md-component=container]","[data-md-component=header-topic]","[data-md-component=outdated]","[data-md-component=logo]","[data-md-component=skip]",...B("navigation.tabs.sticky")?["[data-md-component=tabs]"]:[]]){let n=fe(o),i=fe(o,e);typeof n!="undefined"&&typeof i!="undefined"&&n.replaceWith(i)}let t=Jn(document);for(let[o,n]of Jn(e))t.has(o)?t.delete(o):document.head.appendChild(n);for(let o of t.values()){let n=o.getAttribute("name");n!=="theme-color"&&n!=="color-scheme"&&o.remove()}let r=Se("container");return je($("script",r)).pipe(v(o=>{let n=e.createElement("script");if(o.src){for(let i of o.getAttributeNames())n.setAttribute(i,o.getAttribute(i));return o.replaceWith(n),new F(i=>{n.onload=()=>i.complete()})}else return n.textContent=o.textContent,o.replaceWith(n),O}),X(),ne(document))}function Zn({location$:e,viewport$:t,progress$:r}){let o=ye();if(location.protocol==="file:")return O;let n=ur(o.base);I(document).subscribe(Xn);let i=d(document.body,"click").pipe(We(n),v(([p,c])=>Xa(p,c)),pe()),a=d(window,"popstate").pipe(m(xe),pe());i.pipe(ee(t)).subscribe(([p,{offset:c}])=>{history.replaceState(c,""),history.pushState(null,"",p)}),S(i,a).subscribe(e);let s=e.pipe(Z("pathname"),v(p=>ln(p,{progress$:r}).pipe(ve(()=>(pt(p,!0),O)))),v(Xn),v(Za),pe());return S(s.pipe(ee(e,(p,c)=>c)),s.pipe(v(()=>e),Z("pathname"),v(()=>e),Z("hash")),e.pipe(K((p,c)=>p.pathname===c.pathname&&p.hash===c.hash),v(()=>i),E(()=>history.back()))).subscribe(p=>{var c,l;history.state!==null||!p.hash?window.scrollTo(0,(l=(c=history.state)==null?void 0:c.y)!=null?l:0):(history.scrollRestoration="auto",sn(p.hash),history.scrollRestoration="manual")}),e.subscribe(()=>{history.scrollRestoration="manual"}),d(window,"beforeunload").subscribe(()=>{history.scrollRestoration="auto"}),t.pipe(Z("offset"),_e(100)).subscribe(({offset:p})=>{history.replaceState(p,"")}),s}var ri=Vt(ti());function oi(e){let t=e.separator.split("|").map(n=>n.replace(/(\(\?[!=<][^)]+\))/g,"").length===0?"\uFFFD":n).join("|"),r=new RegExp(t,"img"),o=(n,i,a)=>`${i}${a}`;return n=>{n=n.replace(/[\s*+\-:~^]+/g," ").trim();let i=new RegExp(`(^|${e.separator}|)(${n.replace(/[|\\{}()[\]^$+*?.-]/g,"\\$&").replace(r,"|")})`,"img");return a=>(0,ri.default)(a).replace(i,o).replace(/<\/mark>(\s+)]*>/img,"$1")}}function It(e){return e.type===1}function dr(e){return e.type===3}function ni(e,t){let r=vn(e);return S(I(location.protocol!=="file:"),Ve("search")).pipe(Ae(o=>o),v(()=>t)).subscribe(({config:o,docs:n})=>r.next({type:0,data:{config:o,docs:n,options:{suggest:B("search.suggest")}}})),r}function ii({document$:e}){let t=ye(),r=Ne(new URL("../versions.json",t.base)).pipe(ve(()=>O)),o=r.pipe(m(n=>{let[,i]=t.base.match(/([^/]+)\/?$/);return n.find(({version:a,aliases:s})=>a===i||s.includes(i))||n[0]}));r.pipe(m(n=>new Map(n.map(i=>[`${new URL(`../${i.version}/`,t.base)}`,i]))),v(n=>d(document.body,"click").pipe(b(i=>!i.metaKey&&!i.ctrlKey),ee(o),v(([i,a])=>{if(i.target instanceof Element){let s=i.target.closest("a");if(s&&!s.target&&n.has(s.href)){let p=s.href;return!i.target.closest(".md-version")&&n.get(p)===a?O:(i.preventDefault(),I(p))}}return O}),v(i=>ur(new URL(i)).pipe(m(a=>{let p=xe().href.replace(t.base,i);return a.has(p.split("#")[0])?new URL(p):new URL(i)})))))).subscribe(n=>pt(n,!0)),z([r,o]).subscribe(([n,i])=>{P(".md-header__topic").appendChild(Mn(n,i))}),e.pipe(v(()=>o)).subscribe(n=>{var a;let i=__md_get("__outdated",sessionStorage);if(i===null){i=!0;let s=((a=t.version)==null?void 0:a.default)||"latest";Array.isArray(s)||(s=[s]);e:for(let p of s)for(let c of n.aliases.concat(n.version))if(new RegExp(p,"i").test(c)){i=!1;break e}__md_set("__outdated",i,sessionStorage)}if(i)for(let s of ae("outdated"))s.hidden=!1})}function ns(e,{worker$:t}){let{searchParams:r}=xe();r.has("q")&&(Je("search",!0),e.value=r.get("q"),e.focus(),Ve("search").pipe(Ae(i=>!i)).subscribe(()=>{let i=xe();i.searchParams.delete("q"),history.replaceState({},"",`${i}`)}));let o=et(e),n=S(t.pipe(Ae(It)),d(e,"keyup"),o).pipe(m(()=>e.value),K());return z([n,o]).pipe(m(([i,a])=>({value:i,focus:a})),G(1))}function ai(e,{worker$:t}){let r=new g,o=r.pipe(X(),ne(!0));z([t.pipe(Ae(It)),r],(i,a)=>a).pipe(Z("value")).subscribe(({value:i})=>t.next({type:2,data:i})),r.pipe(Z("focus")).subscribe(({focus:i})=>{i&&Je("search",i)}),d(e.form,"reset").pipe(U(o)).subscribe(()=>e.focus());let n=P("header [for=__search]");return d(n,"click").subscribe(()=>e.focus()),ns(e,{worker$:t}).pipe(E(i=>r.next(i)),L(()=>r.complete()),m(i=>R({ref:e},i)),G(1))}function si(e,{worker$:t,query$:r}){let o=new g,n=tn(e.parentElement).pipe(b(Boolean)),i=e.parentElement,a=P(":scope > :first-child",e),s=P(":scope > :last-child",e);Ve("search").subscribe(l=>s.setAttribute("role",l?"list":"presentation")),o.pipe(ee(r),Ur(t.pipe(Ae(It)))).subscribe(([{items:l},{value:f}])=>{switch(l.length){case 0:a.textContent=f.length?Ee("search.result.none"):Ee("search.result.placeholder");break;case 1:a.textContent=Ee("search.result.one");break;default:let u=sr(l.length);a.textContent=Ee("search.result.other",u)}});let p=o.pipe(E(()=>s.innerHTML=""),v(({items:l})=>S(I(...l.slice(0,10)),I(...l.slice(10)).pipe(Ye(4),Vr(n),v(([f])=>f)))),m(Tn),pe());return p.subscribe(l=>s.appendChild(l)),p.pipe(oe(l=>{let f=fe("details",l);return typeof f=="undefined"?O:d(f,"toggle").pipe(U(o),m(()=>f))})).subscribe(l=>{l.open===!1&&l.offsetTop<=i.scrollTop&&i.scrollTo({top:l.offsetTop})}),t.pipe(b(dr),m(({data:l})=>l)).pipe(E(l=>o.next(l)),L(()=>o.complete()),m(l=>R({ref:e},l)))}function is(e,{query$:t}){return t.pipe(m(({value:r})=>{let o=xe();return o.hash="",r=r.replace(/\s+/g,"+").replace(/&/g,"%26").replace(/=/g,"%3D"),o.search=`q=${r}`,{url:o}}))}function ci(e,t){let r=new g,o=r.pipe(X(),ne(!0));return r.subscribe(({url:n})=>{e.setAttribute("data-clipboard-text",e.href),e.href=`${n}`}),d(e,"click").pipe(U(o)).subscribe(n=>n.preventDefault()),is(e,t).pipe(E(n=>r.next(n)),L(()=>r.complete()),m(n=>R({ref:e},n)))}function pi(e,{worker$:t,keyboard$:r}){let o=new g,n=Se("search-query"),i=S(d(n,"keydown"),d(n,"focus")).pipe(be(se),m(()=>n.value),K());return o.pipe(We(i),m(([{suggest:s},p])=>{let c=p.split(/([\s-]+)/);if(s!=null&&s.length&&c[c.length-1]){let l=s[s.length-1];l.startsWith(c[c.length-1])&&(c[c.length-1]=l)}else c.length=0;return c})).subscribe(s=>e.innerHTML=s.join("").replace(/\s/g," ")),r.pipe(b(({mode:s})=>s==="search")).subscribe(s=>{switch(s.type){case"ArrowRight":e.innerText.length&&n.selectionStart===n.value.length&&(n.value=e.innerText);break}}),t.pipe(b(dr),m(({data:s})=>s)).pipe(E(s=>o.next(s)),L(()=>o.complete()),m(()=>({ref:e})))}function li(e,{index$:t,keyboard$:r}){let o=ye();try{let n=ni(o.search,t),i=Se("search-query",e),a=Se("search-result",e);d(e,"click").pipe(b(({target:p})=>p instanceof Element&&!!p.closest("a"))).subscribe(()=>Je("search",!1)),r.pipe(b(({mode:p})=>p==="search")).subscribe(p=>{let c=Re();switch(p.type){case"Enter":if(c===i){let l=new Map;for(let f of $(":first-child [href]",a)){let u=f.firstElementChild;l.set(f,parseFloat(u.getAttribute("data-md-score")))}if(l.size){let[[f]]=[...l].sort(([,u],[,h])=>h-u);f.click()}p.claim()}break;case"Escape":case"Tab":Je("search",!1),i.blur();break;case"ArrowUp":case"ArrowDown":if(typeof c=="undefined")i.focus();else{let l=[i,...$(":not(details) > [href], summary, details[open] [href]",a)],f=Math.max(0,(Math.max(0,l.indexOf(c))+l.length+(p.type==="ArrowUp"?-1:1))%l.length);l[f].focus()}p.claim();break;default:i!==Re()&&i.focus()}}),r.pipe(b(({mode:p})=>p==="global")).subscribe(p=>{switch(p.type){case"f":case"s":case"/":i.focus(),i.select(),p.claim();break}});let s=ai(i,{worker$:n});return S(s,si(a,{worker$:n,query$:s})).pipe(Pe(...ae("search-share",e).map(p=>ci(p,{query$:s})),...ae("search-suggest",e).map(p=>pi(p,{worker$:n,keyboard$:r}))))}catch(n){return e.hidden=!0,Ke}}function mi(e,{index$:t,location$:r}){return z([t,r.pipe(Q(xe()),b(o=>!!o.searchParams.get("h")))]).pipe(m(([o,n])=>oi(o.config)(n.searchParams.get("h"))),m(o=>{var a;let n=new Map,i=document.createNodeIterator(e,NodeFilter.SHOW_TEXT);for(let s=i.nextNode();s;s=i.nextNode())if((a=s.parentElement)!=null&&a.offsetHeight){let p=s.textContent,c=o(p);c.length>p.length&&n.set(s,c)}for(let[s,p]of n){let{childNodes:c}=x("span",null,p);s.replaceWith(...Array.from(c))}return{ref:e,nodes:n}}))}function as(e,{viewport$:t,main$:r}){let o=e.closest(".md-grid"),n=o.offsetTop-o.parentElement.offsetTop;return z([r,t]).pipe(m(([{offset:i,height:a},{offset:{y:s}}])=>(a=a+Math.min(n,Math.max(0,s-i))-n,{height:a,locked:s>=i+n})),K((i,a)=>i.height===a.height&&i.locked===a.locked))}function Jr(e,o){var n=o,{header$:t}=n,r=io(n,["header$"]);let i=P(".md-sidebar__scrollwrap",e),{y:a}=Ue(i);return C(()=>{let s=new g,p=s.pipe(X(),ne(!0)),c=s.pipe(Le(0,me));return c.pipe(ee(t)).subscribe({next([{height:l},{height:f}]){i.style.height=`${l-2*a}px`,e.style.top=`${f}px`},complete(){i.style.height="",e.style.top=""}}),c.pipe(Ae()).subscribe(()=>{for(let l of $(".md-nav__link--active[href]",e)){if(!l.clientHeight)continue;let f=l.closest(".md-sidebar__scrollwrap");if(typeof f!="undefined"){let u=l.offsetTop-f.offsetTop,{height:h}=ce(f);f.scrollTo({top:u-h/2})}}}),ue($("label[tabindex]",e)).pipe(oe(l=>d(l,"click").pipe(be(se),m(()=>l),U(p)))).subscribe(l=>{let f=P(`[id="${l.htmlFor}"]`);P(`[aria-labelledby="${l.id}"]`).setAttribute("aria-expanded",`${f.checked}`)}),as(e,r).pipe(E(l=>s.next(l)),L(()=>s.complete()),m(l=>R({ref:e},l)))})}function fi(e,t){if(typeof t!="undefined"){let r=`https://api.github.com/repos/${e}/${t}`;return Ct(Ne(`${r}/releases/latest`).pipe(ve(()=>O),m(o=>({version:o.tag_name})),Be({})),Ne(r).pipe(ve(()=>O),m(o=>({stars:o.stargazers_count,forks:o.forks_count})),Be({}))).pipe(m(([o,n])=>R(R({},o),n)))}else{let r=`https://api.github.com/users/${e}`;return Ne(r).pipe(m(o=>({repositories:o.public_repos})),Be({}))}}function ui(e,t){let r=`https://${e}/api/v4/projects/${encodeURIComponent(t)}`;return Ne(r).pipe(ve(()=>O),m(({star_count:o,forks_count:n})=>({stars:o,forks:n})),Be({}))}function di(e){let t=e.match(/^.+github\.com\/([^/]+)\/?([^/]+)?/i);if(t){let[,r,o]=t;return fi(r,o)}if(t=e.match(/^.+?([^/]*gitlab[^/]+)\/(.+?)\/?$/i),t){let[,r,o]=t;return ui(r,o)}return O}var ss;function cs(e){return ss||(ss=C(()=>{let t=__md_get("__source",sessionStorage);if(t)return I(t);if(ae("consent").length){let o=__md_get("__consent");if(!(o&&o.github))return O}return di(e.href).pipe(E(o=>__md_set("__source",o,sessionStorage)))}).pipe(ve(()=>O),b(t=>Object.keys(t).length>0),m(t=>({facts:t})),G(1)))}function hi(e){let t=P(":scope > :last-child",e);return C(()=>{let r=new g;return r.subscribe(({facts:o})=>{t.appendChild(Sn(o)),t.classList.add("md-source__repository--active")}),cs(e).pipe(E(o=>r.next(o)),L(()=>r.complete()),m(o=>R({ref:e},o)))})}function ps(e,{viewport$:t,header$:r}){return ge(document.body).pipe(v(()=>mr(e,{header$:r,viewport$:t})),m(({offset:{y:o}})=>({hidden:o>=10})),Z("hidden"))}function bi(e,t){return C(()=>{let r=new g;return r.subscribe({next({hidden:o}){e.hidden=o},complete(){e.hidden=!1}}),(B("navigation.tabs.sticky")?I({hidden:!1}):ps(e,t)).pipe(E(o=>r.next(o)),L(()=>r.complete()),m(o=>R({ref:e},o)))})}function ls(e,{viewport$:t,header$:r}){let o=new Map,n=$(".md-nav__link",e);for(let s of n){let p=decodeURIComponent(s.hash.substring(1)),c=fe(`[id="${p}"]`);typeof c!="undefined"&&o.set(s,c)}let i=r.pipe(Z("height"),m(({height:s})=>{let p=Se("main"),c=P(":scope > :first-child",p);return s+.8*(c.offsetTop-p.offsetTop)}),pe());return ge(document.body).pipe(Z("height"),v(s=>C(()=>{let p=[];return I([...o].reduce((c,[l,f])=>{for(;p.length&&o.get(p[p.length-1]).tagName>=f.tagName;)p.pop();let u=f.offsetTop;for(;!u&&f.parentElement;)f=f.parentElement,u=f.offsetTop;let h=f.offsetParent;for(;h;h=h.offsetParent)u+=h.offsetTop;return c.set([...p=[...p,l]].reverse(),u)},new Map))}).pipe(m(p=>new Map([...p].sort(([,c],[,l])=>c-l))),We(i),v(([p,c])=>t.pipe(jr(([l,f],{offset:{y:u},size:h})=>{let w=u+h.height>=Math.floor(s.height);for(;f.length;){let[,A]=f[0];if(A-c=u&&!w)f=[l.pop(),...f];else break}return[l,f]},[[],[...p]]),K((l,f)=>l[0]===f[0]&&l[1]===f[1])))))).pipe(m(([s,p])=>({prev:s.map(([c])=>c),next:p.map(([c])=>c)})),Q({prev:[],next:[]}),Ye(2,1),m(([s,p])=>s.prev.length{let i=new g,a=i.pipe(X(),ne(!0));if(i.subscribe(({prev:s,next:p})=>{for(let[c]of p)c.classList.remove("md-nav__link--passed"),c.classList.remove("md-nav__link--active");for(let[c,[l]]of s.entries())l.classList.add("md-nav__link--passed"),l.classList.toggle("md-nav__link--active",c===s.length-1)}),B("toc.follow")){let s=S(t.pipe(_e(1),m(()=>{})),t.pipe(_e(250),m(()=>"smooth")));i.pipe(b(({prev:p})=>p.length>0),We(o.pipe(be(se))),ee(s)).subscribe(([[{prev:p}],c])=>{let[l]=p[p.length-1];if(l.offsetHeight){let f=cr(l);if(typeof f!="undefined"){let u=l.offsetTop-f.offsetTop,{height:h}=ce(f);f.scrollTo({top:u-h/2,behavior:c})}}})}return B("navigation.tracking")&&t.pipe(U(a),Z("offset"),_e(250),Ce(1),U(n.pipe(Ce(1))),st({delay:250}),ee(i)).subscribe(([,{prev:s}])=>{let p=xe(),c=s[s.length-1];if(c&&c.length){let[l]=c,{hash:f}=new URL(l.href);p.hash!==f&&(p.hash=f,history.replaceState({},"",`${p}`))}else p.hash="",history.replaceState({},"",`${p}`)}),ls(e,{viewport$:t,header$:r}).pipe(E(s=>i.next(s)),L(()=>i.complete()),m(s=>R({ref:e},s)))})}function ms(e,{viewport$:t,main$:r,target$:o}){let n=t.pipe(m(({offset:{y:a}})=>a),Ye(2,1),m(([a,s])=>a>s&&s>0),K()),i=r.pipe(m(({active:a})=>a));return z([i,n]).pipe(m(([a,s])=>!(a&&s)),K(),U(o.pipe(Ce(1))),ne(!0),st({delay:250}),m(a=>({hidden:a})))}function gi(e,{viewport$:t,header$:r,main$:o,target$:n}){let i=new g,a=i.pipe(X(),ne(!0));return i.subscribe({next({hidden:s}){e.hidden=s,s?(e.setAttribute("tabindex","-1"),e.blur()):e.removeAttribute("tabindex")},complete(){e.style.top="",e.hidden=!0,e.removeAttribute("tabindex")}}),r.pipe(U(a),Z("height")).subscribe(({height:s})=>{e.style.top=`${s+16}px`}),d(e,"click").subscribe(s=>{s.preventDefault(),window.scrollTo({top:0})}),ms(e,{viewport$:t,main$:o,target$:n}).pipe(E(s=>i.next(s)),L(()=>i.complete()),m(s=>R({ref:e},s)))}function xi({document$:e,viewport$:t}){e.pipe(v(()=>$(".md-ellipsis")),oe(r=>tt(r).pipe(U(e.pipe(Ce(1))),b(o=>o),m(()=>r),Te(1))),b(r=>r.offsetWidth{let o=r.innerText,n=r.closest("a")||r;return n.title=o,B("content.tooltips")?lt(n,{viewport$:t}).pipe(U(e.pipe(Ce(1))),L(()=>n.removeAttribute("title"))):O})).subscribe(),B("content.tooltips")&&e.pipe(v(()=>$(".md-status")),oe(r=>lt(r,{viewport$:t}))).subscribe()}function yi({document$:e,tablet$:t}){e.pipe(v(()=>$(".md-toggle--indeterminate")),E(r=>{r.indeterminate=!0,r.checked=!1}),oe(r=>d(r,"change").pipe(Dr(()=>r.classList.contains("md-toggle--indeterminate")),m(()=>r))),ee(t)).subscribe(([r,o])=>{r.classList.remove("md-toggle--indeterminate"),o&&(r.checked=!1)})}function fs(){return/(iPad|iPhone|iPod)/.test(navigator.userAgent)}function Ei({document$:e}){e.pipe(v(()=>$("[data-md-scrollfix]")),E(t=>t.removeAttribute("data-md-scrollfix")),b(fs),oe(t=>d(t,"touchstart").pipe(m(()=>t)))).subscribe(t=>{let r=t.scrollTop;r===0?t.scrollTop=1:r+t.offsetHeight===t.scrollHeight&&(t.scrollTop=r-1)})}function wi({viewport$:e,tablet$:t}){z([Ve("search"),t]).pipe(m(([r,o])=>r&&!o),v(r=>I(r).pipe(Ge(r?400:100))),ee(e)).subscribe(([r,{offset:{y:o}}])=>{if(r)document.body.setAttribute("data-md-scrolllock",""),document.body.style.top=`-${o}px`;else{let n=-1*parseInt(document.body.style.top,10);document.body.removeAttribute("data-md-scrolllock"),document.body.style.top="",n&&window.scrollTo(0,n)}})}Object.entries||(Object.entries=function(e){let t=[];for(let r of Object.keys(e))t.push([r,e[r]]);return t});Object.values||(Object.values=function(e){let t=[];for(let r of Object.keys(e))t.push(e[r]);return t});typeof Element!="undefined"&&(Element.prototype.scrollTo||(Element.prototype.scrollTo=function(e,t){typeof e=="object"?(this.scrollLeft=e.left,this.scrollTop=e.top):(this.scrollLeft=e,this.scrollTop=t)}),Element.prototype.replaceWith||(Element.prototype.replaceWith=function(...e){let t=this.parentNode;if(t){e.length===0&&t.removeChild(this);for(let r=e.length-1;r>=0;r--){let o=e[r];typeof o=="string"?o=document.createTextNode(o):o.parentNode&&o.parentNode.removeChild(o),r?t.insertBefore(this.previousSibling,o):t.replaceChild(o,this)}}}));function us(){return location.protocol==="file:"?wt(`${new URL("search/search_index.js",Xr.base)}`).pipe(m(()=>__index),G(1)):Ne(new URL("search/search_index.json",Xr.base))}document.documentElement.classList.remove("no-js");document.documentElement.classList.add("js");var ot=Yo(),jt=nn(),Ot=cn(jt),Zr=on(),Oe=bn(),hr=$t("(min-width: 960px)"),Si=$t("(min-width: 1220px)"),Oi=pn(),Xr=ye(),Mi=document.forms.namedItem("search")?us():Ke,eo=new g;Bn({alert$:eo});var to=new g;B("navigation.instant")&&Zn({location$:jt,viewport$:Oe,progress$:to}).subscribe(ot);var Ti;((Ti=Xr.version)==null?void 0:Ti.provider)==="mike"&&ii({document$:ot});S(jt,Ot).pipe(Ge(125)).subscribe(()=>{Je("drawer",!1),Je("search",!1)});Zr.pipe(b(({mode:e})=>e==="global")).subscribe(e=>{switch(e.type){case"p":case",":let t=fe("link[rel=prev]");typeof t!="undefined"&&pt(t);break;case"n":case".":let r=fe("link[rel=next]");typeof r!="undefined"&&pt(r);break;case"Enter":let o=Re();o instanceof HTMLLabelElement&&o.click()}});xi({viewport$:Oe,document$:ot});yi({document$:ot,tablet$:hr});Ei({document$:ot});wi({viewport$:Oe,tablet$:hr});var rt=Nn(Se("header"),{viewport$:Oe}),Ft=ot.pipe(m(()=>Se("main")),v(e=>Qn(e,{viewport$:Oe,header$:rt})),G(1)),ds=S(...ae("consent").map(e=>xn(e,{target$:Ot})),...ae("dialog").map(e=>Dn(e,{alert$:eo})),...ae("header").map(e=>zn(e,{viewport$:Oe,header$:rt,main$:Ft})),...ae("palette").map(e=>Kn(e)),...ae("progress").map(e=>Yn(e,{progress$:to})),...ae("search").map(e=>li(e,{index$:Mi,keyboard$:Zr})),...ae("source").map(e=>hi(e))),hs=C(()=>S(...ae("announce").map(e=>gn(e)),...ae("content").map(e=>Un(e,{viewport$:Oe,target$:Ot,print$:Oi})),...ae("content").map(e=>B("search.highlight")?mi(e,{index$:Mi,location$:jt}):O),...ae("header-title").map(e=>qn(e,{viewport$:Oe,header$:rt})),...ae("sidebar").map(e=>e.getAttribute("data-md-type")==="navigation"?Nr(Si,()=>Jr(e,{viewport$:Oe,header$:rt,main$:Ft})):Nr(hr,()=>Jr(e,{viewport$:Oe,header$:rt,main$:Ft}))),...ae("tabs").map(e=>bi(e,{viewport$:Oe,header$:rt})),...ae("toc").map(e=>vi(e,{viewport$:Oe,header$:rt,main$:Ft,target$:Ot})),...ae("top").map(e=>gi(e,{viewport$:Oe,header$:rt,main$:Ft,target$:Ot})))),Li=ot.pipe(v(()=>hs),Pe(ds),G(1));Li.subscribe();window.document$=ot;window.location$=jt;window.target$=Ot;window.keyboard$=Zr;window.viewport$=Oe;window.tablet$=hr;window.screen$=Si;window.print$=Oi;window.alert$=eo;window.progress$=to;window.component$=Li;})(); +//# sourceMappingURL=bundle.fe8b6f2b.min.js.map + diff --git a/assets/javascripts/bundle.fe8b6f2b.min.js.map b/assets/javascripts/bundle.fe8b6f2b.min.js.map new file mode 100644 index 0000000..8263585 --- /dev/null +++ b/assets/javascripts/bundle.fe8b6f2b.min.js.map @@ -0,0 +1,7 @@ +{ + "version": 3, + "sources": ["node_modules/focus-visible/dist/focus-visible.js", "node_modules/clipboard/dist/clipboard.js", "node_modules/escape-html/index.js", "src/templates/assets/javascripts/bundle.ts", "node_modules/rxjs/node_modules/tslib/tslib.es6.js", "node_modules/rxjs/src/internal/util/isFunction.ts", "node_modules/rxjs/src/internal/util/createErrorClass.ts", "node_modules/rxjs/src/internal/util/UnsubscriptionError.ts", "node_modules/rxjs/src/internal/util/arrRemove.ts", "node_modules/rxjs/src/internal/Subscription.ts", "node_modules/rxjs/src/internal/config.ts", "node_modules/rxjs/src/internal/scheduler/timeoutProvider.ts", "node_modules/rxjs/src/internal/util/reportUnhandledError.ts", "node_modules/rxjs/src/internal/util/noop.ts", "node_modules/rxjs/src/internal/NotificationFactories.ts", "node_modules/rxjs/src/internal/util/errorContext.ts", "node_modules/rxjs/src/internal/Subscriber.ts", "node_modules/rxjs/src/internal/symbol/observable.ts", "node_modules/rxjs/src/internal/util/identity.ts", "node_modules/rxjs/src/internal/util/pipe.ts", "node_modules/rxjs/src/internal/Observable.ts", "node_modules/rxjs/src/internal/util/lift.ts", "node_modules/rxjs/src/internal/operators/OperatorSubscriber.ts", "node_modules/rxjs/src/internal/scheduler/animationFrameProvider.ts", "node_modules/rxjs/src/internal/util/ObjectUnsubscribedError.ts", "node_modules/rxjs/src/internal/Subject.ts", "node_modules/rxjs/src/internal/BehaviorSubject.ts", "node_modules/rxjs/src/internal/scheduler/dateTimestampProvider.ts", "node_modules/rxjs/src/internal/ReplaySubject.ts", "node_modules/rxjs/src/internal/scheduler/Action.ts", "node_modules/rxjs/src/internal/scheduler/intervalProvider.ts", "node_modules/rxjs/src/internal/scheduler/AsyncAction.ts", "node_modules/rxjs/src/internal/Scheduler.ts", "node_modules/rxjs/src/internal/scheduler/AsyncScheduler.ts", "node_modules/rxjs/src/internal/scheduler/async.ts", "node_modules/rxjs/src/internal/scheduler/QueueAction.ts", "node_modules/rxjs/src/internal/scheduler/QueueScheduler.ts", "node_modules/rxjs/src/internal/scheduler/queue.ts", "node_modules/rxjs/src/internal/scheduler/AnimationFrameAction.ts", "node_modules/rxjs/src/internal/scheduler/AnimationFrameScheduler.ts", "node_modules/rxjs/src/internal/scheduler/animationFrame.ts", "node_modules/rxjs/src/internal/observable/empty.ts", "node_modules/rxjs/src/internal/util/isScheduler.ts", "node_modules/rxjs/src/internal/util/args.ts", "node_modules/rxjs/src/internal/util/isArrayLike.ts", "node_modules/rxjs/src/internal/util/isPromise.ts", "node_modules/rxjs/src/internal/util/isInteropObservable.ts", "node_modules/rxjs/src/internal/util/isAsyncIterable.ts", "node_modules/rxjs/src/internal/util/throwUnobservableError.ts", "node_modules/rxjs/src/internal/symbol/iterator.ts", "node_modules/rxjs/src/internal/util/isIterable.ts", "node_modules/rxjs/src/internal/util/isReadableStreamLike.ts", "node_modules/rxjs/src/internal/observable/innerFrom.ts", "node_modules/rxjs/src/internal/util/executeSchedule.ts", "node_modules/rxjs/src/internal/operators/observeOn.ts", "node_modules/rxjs/src/internal/operators/subscribeOn.ts", "node_modules/rxjs/src/internal/scheduled/scheduleObservable.ts", "node_modules/rxjs/src/internal/scheduled/schedulePromise.ts", "node_modules/rxjs/src/internal/scheduled/scheduleArray.ts", "node_modules/rxjs/src/internal/scheduled/scheduleIterable.ts", "node_modules/rxjs/src/internal/scheduled/scheduleAsyncIterable.ts", "node_modules/rxjs/src/internal/scheduled/scheduleReadableStreamLike.ts", "node_modules/rxjs/src/internal/scheduled/scheduled.ts", "node_modules/rxjs/src/internal/observable/from.ts", "node_modules/rxjs/src/internal/observable/of.ts", "node_modules/rxjs/src/internal/observable/throwError.ts", "node_modules/rxjs/src/internal/util/EmptyError.ts", "node_modules/rxjs/src/internal/util/isDate.ts", "node_modules/rxjs/src/internal/operators/map.ts", "node_modules/rxjs/src/internal/util/mapOneOrManyArgs.ts", "node_modules/rxjs/src/internal/util/argsArgArrayOrObject.ts", "node_modules/rxjs/src/internal/util/createObject.ts", "node_modules/rxjs/src/internal/observable/combineLatest.ts", "node_modules/rxjs/src/internal/operators/mergeInternals.ts", "node_modules/rxjs/src/internal/operators/mergeMap.ts", "node_modules/rxjs/src/internal/operators/mergeAll.ts", "node_modules/rxjs/src/internal/operators/concatAll.ts", "node_modules/rxjs/src/internal/observable/concat.ts", "node_modules/rxjs/src/internal/observable/defer.ts", "node_modules/rxjs/src/internal/observable/fromEvent.ts", "node_modules/rxjs/src/internal/observable/fromEventPattern.ts", "node_modules/rxjs/src/internal/observable/timer.ts", "node_modules/rxjs/src/internal/observable/merge.ts", "node_modules/rxjs/src/internal/observable/never.ts", "node_modules/rxjs/src/internal/util/argsOrArgArray.ts", "node_modules/rxjs/src/internal/operators/filter.ts", "node_modules/rxjs/src/internal/observable/zip.ts", "node_modules/rxjs/src/internal/operators/audit.ts", "node_modules/rxjs/src/internal/operators/auditTime.ts", "node_modules/rxjs/src/internal/operators/bufferCount.ts", "node_modules/rxjs/src/internal/operators/catchError.ts", "node_modules/rxjs/src/internal/operators/scanInternals.ts", "node_modules/rxjs/src/internal/operators/combineLatest.ts", "node_modules/rxjs/src/internal/operators/combineLatestWith.ts", "node_modules/rxjs/src/internal/operators/debounce.ts", "node_modules/rxjs/src/internal/operators/debounceTime.ts", "node_modules/rxjs/src/internal/operators/defaultIfEmpty.ts", "node_modules/rxjs/src/internal/operators/take.ts", "node_modules/rxjs/src/internal/operators/ignoreElements.ts", "node_modules/rxjs/src/internal/operators/mapTo.ts", "node_modules/rxjs/src/internal/operators/delayWhen.ts", "node_modules/rxjs/src/internal/operators/delay.ts", "node_modules/rxjs/src/internal/operators/distinctUntilChanged.ts", "node_modules/rxjs/src/internal/operators/distinctUntilKeyChanged.ts", "node_modules/rxjs/src/internal/operators/throwIfEmpty.ts", "node_modules/rxjs/src/internal/operators/endWith.ts", "node_modules/rxjs/src/internal/operators/finalize.ts", "node_modules/rxjs/src/internal/operators/first.ts", "node_modules/rxjs/src/internal/operators/takeLast.ts", "node_modules/rxjs/src/internal/operators/merge.ts", "node_modules/rxjs/src/internal/operators/mergeWith.ts", "node_modules/rxjs/src/internal/operators/repeat.ts", "node_modules/rxjs/src/internal/operators/scan.ts", "node_modules/rxjs/src/internal/operators/share.ts", "node_modules/rxjs/src/internal/operators/shareReplay.ts", "node_modules/rxjs/src/internal/operators/skip.ts", "node_modules/rxjs/src/internal/operators/skipUntil.ts", "node_modules/rxjs/src/internal/operators/startWith.ts", "node_modules/rxjs/src/internal/operators/switchMap.ts", "node_modules/rxjs/src/internal/operators/takeUntil.ts", "node_modules/rxjs/src/internal/operators/takeWhile.ts", "node_modules/rxjs/src/internal/operators/tap.ts", "node_modules/rxjs/src/internal/operators/throttle.ts", "node_modules/rxjs/src/internal/operators/throttleTime.ts", "node_modules/rxjs/src/internal/operators/withLatestFrom.ts", "node_modules/rxjs/src/internal/operators/zip.ts", "node_modules/rxjs/src/internal/operators/zipWith.ts", "src/templates/assets/javascripts/browser/document/index.ts", "src/templates/assets/javascripts/browser/element/_/index.ts", "src/templates/assets/javascripts/browser/element/focus/index.ts", "src/templates/assets/javascripts/browser/element/hover/index.ts", "src/templates/assets/javascripts/utilities/h/index.ts", "src/templates/assets/javascripts/utilities/round/index.ts", "src/templates/assets/javascripts/browser/script/index.ts", "src/templates/assets/javascripts/browser/element/size/_/index.ts", "src/templates/assets/javascripts/browser/element/size/content/index.ts", "src/templates/assets/javascripts/browser/element/offset/_/index.ts", "src/templates/assets/javascripts/browser/element/offset/content/index.ts", "src/templates/assets/javascripts/browser/element/visibility/index.ts", "src/templates/assets/javascripts/browser/toggle/index.ts", "src/templates/assets/javascripts/browser/keyboard/index.ts", "src/templates/assets/javascripts/browser/location/_/index.ts", "src/templates/assets/javascripts/browser/location/hash/index.ts", "src/templates/assets/javascripts/browser/media/index.ts", "src/templates/assets/javascripts/browser/request/index.ts", "src/templates/assets/javascripts/browser/viewport/offset/index.ts", "src/templates/assets/javascripts/browser/viewport/size/index.ts", "src/templates/assets/javascripts/browser/viewport/_/index.ts", "src/templates/assets/javascripts/browser/viewport/at/index.ts", "src/templates/assets/javascripts/browser/worker/index.ts", "src/templates/assets/javascripts/_/index.ts", "src/templates/assets/javascripts/components/_/index.ts", "src/templates/assets/javascripts/components/announce/index.ts", "src/templates/assets/javascripts/components/consent/index.ts", "src/templates/assets/javascripts/templates/tooltip/index.tsx", "src/templates/assets/javascripts/templates/annotation/index.tsx", "src/templates/assets/javascripts/templates/clipboard/index.tsx", "src/templates/assets/javascripts/templates/search/index.tsx", "src/templates/assets/javascripts/templates/source/index.tsx", "src/templates/assets/javascripts/templates/tabbed/index.tsx", "src/templates/assets/javascripts/templates/table/index.tsx", "src/templates/assets/javascripts/templates/version/index.tsx", "src/templates/assets/javascripts/components/tooltip2/index.ts", "src/templates/assets/javascripts/components/content/annotation/_/index.ts", "src/templates/assets/javascripts/components/content/annotation/list/index.ts", "src/templates/assets/javascripts/components/content/annotation/block/index.ts", "src/templates/assets/javascripts/components/content/code/_/index.ts", "src/templates/assets/javascripts/components/content/details/index.ts", "src/templates/assets/javascripts/components/content/mermaid/index.css", "src/templates/assets/javascripts/components/content/mermaid/index.ts", "src/templates/assets/javascripts/components/content/table/index.ts", "src/templates/assets/javascripts/components/content/tabs/index.ts", "src/templates/assets/javascripts/components/content/_/index.ts", "src/templates/assets/javascripts/components/dialog/index.ts", "src/templates/assets/javascripts/components/tooltip/index.ts", "src/templates/assets/javascripts/components/header/_/index.ts", "src/templates/assets/javascripts/components/header/title/index.ts", "src/templates/assets/javascripts/components/main/index.ts", "src/templates/assets/javascripts/components/palette/index.ts", "src/templates/assets/javascripts/components/progress/index.ts", "src/templates/assets/javascripts/integrations/clipboard/index.ts", "src/templates/assets/javascripts/integrations/sitemap/index.ts", "src/templates/assets/javascripts/integrations/instant/index.ts", "src/templates/assets/javascripts/integrations/search/highlighter/index.ts", "src/templates/assets/javascripts/integrations/search/worker/message/index.ts", "src/templates/assets/javascripts/integrations/search/worker/_/index.ts", "src/templates/assets/javascripts/integrations/version/index.ts", "src/templates/assets/javascripts/components/search/query/index.ts", "src/templates/assets/javascripts/components/search/result/index.ts", "src/templates/assets/javascripts/components/search/share/index.ts", "src/templates/assets/javascripts/components/search/suggest/index.ts", "src/templates/assets/javascripts/components/search/_/index.ts", "src/templates/assets/javascripts/components/search/highlight/index.ts", "src/templates/assets/javascripts/components/sidebar/index.ts", "src/templates/assets/javascripts/components/source/facts/github/index.ts", "src/templates/assets/javascripts/components/source/facts/gitlab/index.ts", "src/templates/assets/javascripts/components/source/facts/_/index.ts", "src/templates/assets/javascripts/components/source/_/index.ts", "src/templates/assets/javascripts/components/tabs/index.ts", "src/templates/assets/javascripts/components/toc/index.ts", "src/templates/assets/javascripts/components/top/index.ts", "src/templates/assets/javascripts/patches/ellipsis/index.ts", "src/templates/assets/javascripts/patches/indeterminate/index.ts", "src/templates/assets/javascripts/patches/scrollfix/index.ts", "src/templates/assets/javascripts/patches/scrolllock/index.ts", "src/templates/assets/javascripts/polyfills/index.ts"], + "sourcesContent": ["(function (global, factory) {\n typeof exports === 'object' && typeof module !== 'undefined' ? factory() :\n typeof define === 'function' && define.amd ? define(factory) :\n (factory());\n}(this, (function () { 'use strict';\n\n /**\n * Applies the :focus-visible polyfill at the given scope.\n * A scope in this case is either the top-level Document or a Shadow Root.\n *\n * @param {(Document|ShadowRoot)} scope\n * @see https://github.com/WICG/focus-visible\n */\n function applyFocusVisiblePolyfill(scope) {\n var hadKeyboardEvent = true;\n var hadFocusVisibleRecently = false;\n var hadFocusVisibleRecentlyTimeout = null;\n\n var inputTypesAllowlist = {\n text: true,\n search: true,\n url: true,\n tel: true,\n email: true,\n password: true,\n number: true,\n date: true,\n month: true,\n week: true,\n time: true,\n datetime: true,\n 'datetime-local': true\n };\n\n /**\n * Helper function for legacy browsers and iframes which sometimes focus\n * elements like document, body, and non-interactive SVG.\n * @param {Element} el\n */\n function isValidFocusTarget(el) {\n if (\n el &&\n el !== document &&\n el.nodeName !== 'HTML' &&\n el.nodeName !== 'BODY' &&\n 'classList' in el &&\n 'contains' in el.classList\n ) {\n return true;\n }\n return false;\n }\n\n /**\n * Computes whether the given element should automatically trigger the\n * `focus-visible` class being added, i.e. whether it should always match\n * `:focus-visible` when focused.\n * @param {Element} el\n * @return {boolean}\n */\n function focusTriggersKeyboardModality(el) {\n var type = el.type;\n var tagName = el.tagName;\n\n if (tagName === 'INPUT' && inputTypesAllowlist[type] && !el.readOnly) {\n return true;\n }\n\n if (tagName === 'TEXTAREA' && !el.readOnly) {\n return true;\n }\n\n if (el.isContentEditable) {\n return true;\n }\n\n return false;\n }\n\n /**\n * Add the `focus-visible` class to the given element if it was not added by\n * the author.\n * @param {Element} el\n */\n function addFocusVisibleClass(el) {\n if (el.classList.contains('focus-visible')) {\n return;\n }\n el.classList.add('focus-visible');\n el.setAttribute('data-focus-visible-added', '');\n }\n\n /**\n * Remove the `focus-visible` class from the given element if it was not\n * originally added by the author.\n * @param {Element} el\n */\n function removeFocusVisibleClass(el) {\n if (!el.hasAttribute('data-focus-visible-added')) {\n return;\n }\n el.classList.remove('focus-visible');\n el.removeAttribute('data-focus-visible-added');\n }\n\n /**\n * If the most recent user interaction was via the keyboard;\n * and the key press did not include a meta, alt/option, or control key;\n * then the modality is keyboard. Otherwise, the modality is not keyboard.\n * Apply `focus-visible` to any current active element and keep track\n * of our keyboard modality state with `hadKeyboardEvent`.\n * @param {KeyboardEvent} e\n */\n function onKeyDown(e) {\n if (e.metaKey || e.altKey || e.ctrlKey) {\n return;\n }\n\n if (isValidFocusTarget(scope.activeElement)) {\n addFocusVisibleClass(scope.activeElement);\n }\n\n hadKeyboardEvent = true;\n }\n\n /**\n * If at any point a user clicks with a pointing device, ensure that we change\n * the modality away from keyboard.\n * This avoids the situation where a user presses a key on an already focused\n * element, and then clicks on a different element, focusing it with a\n * pointing device, while we still think we're in keyboard modality.\n * @param {Event} e\n */\n function onPointerDown(e) {\n hadKeyboardEvent = false;\n }\n\n /**\n * On `focus`, add the `focus-visible` class to the target if:\n * - the target received focus as a result of keyboard navigation, or\n * - the event target is an element that will likely require interaction\n * via the keyboard (e.g. a text box)\n * @param {Event} e\n */\n function onFocus(e) {\n // Prevent IE from focusing the document or HTML element.\n if (!isValidFocusTarget(e.target)) {\n return;\n }\n\n if (hadKeyboardEvent || focusTriggersKeyboardModality(e.target)) {\n addFocusVisibleClass(e.target);\n }\n }\n\n /**\n * On `blur`, remove the `focus-visible` class from the target.\n * @param {Event} e\n */\n function onBlur(e) {\n if (!isValidFocusTarget(e.target)) {\n return;\n }\n\n if (\n e.target.classList.contains('focus-visible') ||\n e.target.hasAttribute('data-focus-visible-added')\n ) {\n // To detect a tab/window switch, we look for a blur event followed\n // rapidly by a visibility change.\n // If we don't see a visibility change within 100ms, it's probably a\n // regular focus change.\n hadFocusVisibleRecently = true;\n window.clearTimeout(hadFocusVisibleRecentlyTimeout);\n hadFocusVisibleRecentlyTimeout = window.setTimeout(function() {\n hadFocusVisibleRecently = false;\n }, 100);\n removeFocusVisibleClass(e.target);\n }\n }\n\n /**\n * If the user changes tabs, keep track of whether or not the previously\n * focused element had .focus-visible.\n * @param {Event} e\n */\n function onVisibilityChange(e) {\n if (document.visibilityState === 'hidden') {\n // If the tab becomes active again, the browser will handle calling focus\n // on the element (Safari actually calls it twice).\n // If this tab change caused a blur on an element with focus-visible,\n // re-apply the class when the user switches back to the tab.\n if (hadFocusVisibleRecently) {\n hadKeyboardEvent = true;\n }\n addInitialPointerMoveListeners();\n }\n }\n\n /**\n * Add a group of listeners to detect usage of any pointing devices.\n * These listeners will be added when the polyfill first loads, and anytime\n * the window is blurred, so that they are active when the window regains\n * focus.\n */\n function addInitialPointerMoveListeners() {\n document.addEventListener('mousemove', onInitialPointerMove);\n document.addEventListener('mousedown', onInitialPointerMove);\n document.addEventListener('mouseup', onInitialPointerMove);\n document.addEventListener('pointermove', onInitialPointerMove);\n document.addEventListener('pointerdown', onInitialPointerMove);\n document.addEventListener('pointerup', onInitialPointerMove);\n document.addEventListener('touchmove', onInitialPointerMove);\n document.addEventListener('touchstart', onInitialPointerMove);\n document.addEventListener('touchend', onInitialPointerMove);\n }\n\n function removeInitialPointerMoveListeners() {\n document.removeEventListener('mousemove', onInitialPointerMove);\n document.removeEventListener('mousedown', onInitialPointerMove);\n document.removeEventListener('mouseup', onInitialPointerMove);\n document.removeEventListener('pointermove', onInitialPointerMove);\n document.removeEventListener('pointerdown', onInitialPointerMove);\n document.removeEventListener('pointerup', onInitialPointerMove);\n document.removeEventListener('touchmove', onInitialPointerMove);\n document.removeEventListener('touchstart', onInitialPointerMove);\n document.removeEventListener('touchend', onInitialPointerMove);\n }\n\n /**\n * When the polfyill first loads, assume the user is in keyboard modality.\n * If any event is received from a pointing device (e.g. mouse, pointer,\n * touch), turn off keyboard modality.\n * This accounts for situations where focus enters the page from the URL bar.\n * @param {Event} e\n */\n function onInitialPointerMove(e) {\n // Work around a Safari quirk that fires a mousemove on whenever the\n // window blurs, even if you're tabbing out of the page. \u00AF\\_(\u30C4)_/\u00AF\n if (e.target.nodeName && e.target.nodeName.toLowerCase() === 'html') {\n return;\n }\n\n hadKeyboardEvent = false;\n removeInitialPointerMoveListeners();\n }\n\n // For some kinds of state, we are interested in changes at the global scope\n // only. For example, global pointer input, global key presses and global\n // visibility change should affect the state at every scope:\n document.addEventListener('keydown', onKeyDown, true);\n document.addEventListener('mousedown', onPointerDown, true);\n document.addEventListener('pointerdown', onPointerDown, true);\n document.addEventListener('touchstart', onPointerDown, true);\n document.addEventListener('visibilitychange', onVisibilityChange, true);\n\n addInitialPointerMoveListeners();\n\n // For focus and blur, we specifically care about state changes in the local\n // scope. This is because focus / blur events that originate from within a\n // shadow root are not re-dispatched from the host element if it was already\n // the active element in its own scope:\n scope.addEventListener('focus', onFocus, true);\n scope.addEventListener('blur', onBlur, true);\n\n // We detect that a node is a ShadowRoot by ensuring that it is a\n // DocumentFragment and also has a host property. This check covers native\n // implementation and polyfill implementation transparently. If we only cared\n // about the native implementation, we could just check if the scope was\n // an instance of a ShadowRoot.\n if (scope.nodeType === Node.DOCUMENT_FRAGMENT_NODE && scope.host) {\n // Since a ShadowRoot is a special kind of DocumentFragment, it does not\n // have a root element to add a class to. So, we add this attribute to the\n // host element instead:\n scope.host.setAttribute('data-js-focus-visible', '');\n } else if (scope.nodeType === Node.DOCUMENT_NODE) {\n document.documentElement.classList.add('js-focus-visible');\n document.documentElement.setAttribute('data-js-focus-visible', '');\n }\n }\n\n // It is important to wrap all references to global window and document in\n // these checks to support server-side rendering use cases\n // @see https://github.com/WICG/focus-visible/issues/199\n if (typeof window !== 'undefined' && typeof document !== 'undefined') {\n // Make the polyfill helper globally available. This can be used as a signal\n // to interested libraries that wish to coordinate with the polyfill for e.g.,\n // applying the polyfill to a shadow root:\n window.applyFocusVisiblePolyfill = applyFocusVisiblePolyfill;\n\n // Notify interested libraries of the polyfill's presence, in case the\n // polyfill was loaded lazily:\n var event;\n\n try {\n event = new CustomEvent('focus-visible-polyfill-ready');\n } catch (error) {\n // IE11 does not support using CustomEvent as a constructor directly:\n event = document.createEvent('CustomEvent');\n event.initCustomEvent('focus-visible-polyfill-ready', false, false, {});\n }\n\n window.dispatchEvent(event);\n }\n\n if (typeof document !== 'undefined') {\n // Apply the polyfill to the global document, so that no JavaScript\n // coordination is required to use the polyfill in the top-level document:\n applyFocusVisiblePolyfill(document);\n }\n\n})));\n", "/*!\n * clipboard.js v2.0.11\n * https://clipboardjs.com/\n *\n * Licensed MIT \u00A9 Zeno Rocha\n */\n(function webpackUniversalModuleDefinition(root, factory) {\n\tif(typeof exports === 'object' && typeof module === 'object')\n\t\tmodule.exports = factory();\n\telse if(typeof define === 'function' && define.amd)\n\t\tdefine([], factory);\n\telse if(typeof exports === 'object')\n\t\texports[\"ClipboardJS\"] = factory();\n\telse\n\t\troot[\"ClipboardJS\"] = factory();\n})(this, function() {\nreturn /******/ (function() { // webpackBootstrap\n/******/ \tvar __webpack_modules__ = ({\n\n/***/ 686:\n/***/ (function(__unused_webpack_module, __webpack_exports__, __webpack_require__) {\n\n\"use strict\";\n\n// EXPORTS\n__webpack_require__.d(__webpack_exports__, {\n \"default\": function() { return /* binding */ clipboard; }\n});\n\n// EXTERNAL MODULE: ./node_modules/tiny-emitter/index.js\nvar tiny_emitter = __webpack_require__(279);\nvar tiny_emitter_default = /*#__PURE__*/__webpack_require__.n(tiny_emitter);\n// EXTERNAL MODULE: ./node_modules/good-listener/src/listen.js\nvar listen = __webpack_require__(370);\nvar listen_default = /*#__PURE__*/__webpack_require__.n(listen);\n// EXTERNAL MODULE: ./node_modules/select/src/select.js\nvar src_select = __webpack_require__(817);\nvar select_default = /*#__PURE__*/__webpack_require__.n(src_select);\n;// CONCATENATED MODULE: ./src/common/command.js\n/**\n * Executes a given operation type.\n * @param {String} type\n * @return {Boolean}\n */\nfunction command(type) {\n try {\n return document.execCommand(type);\n } catch (err) {\n return false;\n }\n}\n;// CONCATENATED MODULE: ./src/actions/cut.js\n\n\n/**\n * Cut action wrapper.\n * @param {String|HTMLElement} target\n * @return {String}\n */\n\nvar ClipboardActionCut = function ClipboardActionCut(target) {\n var selectedText = select_default()(target);\n command('cut');\n return selectedText;\n};\n\n/* harmony default export */ var actions_cut = (ClipboardActionCut);\n;// CONCATENATED MODULE: ./src/common/create-fake-element.js\n/**\n * Creates a fake textarea element with a value.\n * @param {String} value\n * @return {HTMLElement}\n */\nfunction createFakeElement(value) {\n var isRTL = document.documentElement.getAttribute('dir') === 'rtl';\n var fakeElement = document.createElement('textarea'); // Prevent zooming on iOS\n\n fakeElement.style.fontSize = '12pt'; // Reset box model\n\n fakeElement.style.border = '0';\n fakeElement.style.padding = '0';\n fakeElement.style.margin = '0'; // Move element out of screen horizontally\n\n fakeElement.style.position = 'absolute';\n fakeElement.style[isRTL ? 'right' : 'left'] = '-9999px'; // Move element to the same position vertically\n\n var yPosition = window.pageYOffset || document.documentElement.scrollTop;\n fakeElement.style.top = \"\".concat(yPosition, \"px\");\n fakeElement.setAttribute('readonly', '');\n fakeElement.value = value;\n return fakeElement;\n}\n;// CONCATENATED MODULE: ./src/actions/copy.js\n\n\n\n/**\n * Create fake copy action wrapper using a fake element.\n * @param {String} target\n * @param {Object} options\n * @return {String}\n */\n\nvar fakeCopyAction = function fakeCopyAction(value, options) {\n var fakeElement = createFakeElement(value);\n options.container.appendChild(fakeElement);\n var selectedText = select_default()(fakeElement);\n command('copy');\n fakeElement.remove();\n return selectedText;\n};\n/**\n * Copy action wrapper.\n * @param {String|HTMLElement} target\n * @param {Object} options\n * @return {String}\n */\n\n\nvar ClipboardActionCopy = function ClipboardActionCopy(target) {\n var options = arguments.length > 1 && arguments[1] !== undefined ? arguments[1] : {\n container: document.body\n };\n var selectedText = '';\n\n if (typeof target === 'string') {\n selectedText = fakeCopyAction(target, options);\n } else if (target instanceof HTMLInputElement && !['text', 'search', 'url', 'tel', 'password'].includes(target === null || target === void 0 ? void 0 : target.type)) {\n // If input type doesn't support `setSelectionRange`. Simulate it. https://developer.mozilla.org/en-US/docs/Web/API/HTMLInputElement/setSelectionRange\n selectedText = fakeCopyAction(target.value, options);\n } else {\n selectedText = select_default()(target);\n command('copy');\n }\n\n return selectedText;\n};\n\n/* harmony default export */ var actions_copy = (ClipboardActionCopy);\n;// CONCATENATED MODULE: ./src/actions/default.js\nfunction _typeof(obj) { \"@babel/helpers - typeof\"; if (typeof Symbol === \"function\" && typeof Symbol.iterator === \"symbol\") { _typeof = function _typeof(obj) { return typeof obj; }; } else { _typeof = function _typeof(obj) { return obj && typeof Symbol === \"function\" && obj.constructor === Symbol && obj !== Symbol.prototype ? \"symbol\" : typeof obj; }; } return _typeof(obj); }\n\n\n\n/**\n * Inner function which performs selection from either `text` or `target`\n * properties and then executes copy or cut operations.\n * @param {Object} options\n */\n\nvar ClipboardActionDefault = function ClipboardActionDefault() {\n var options = arguments.length > 0 && arguments[0] !== undefined ? arguments[0] : {};\n // Defines base properties passed from constructor.\n var _options$action = options.action,\n action = _options$action === void 0 ? 'copy' : _options$action,\n container = options.container,\n target = options.target,\n text = options.text; // Sets the `action` to be performed which can be either 'copy' or 'cut'.\n\n if (action !== 'copy' && action !== 'cut') {\n throw new Error('Invalid \"action\" value, use either \"copy\" or \"cut\"');\n } // Sets the `target` property using an element that will be have its content copied.\n\n\n if (target !== undefined) {\n if (target && _typeof(target) === 'object' && target.nodeType === 1) {\n if (action === 'copy' && target.hasAttribute('disabled')) {\n throw new Error('Invalid \"target\" attribute. Please use \"readonly\" instead of \"disabled\" attribute');\n }\n\n if (action === 'cut' && (target.hasAttribute('readonly') || target.hasAttribute('disabled'))) {\n throw new Error('Invalid \"target\" attribute. You can\\'t cut text from elements with \"readonly\" or \"disabled\" attributes');\n }\n } else {\n throw new Error('Invalid \"target\" value, use a valid Element');\n }\n } // Define selection strategy based on `text` property.\n\n\n if (text) {\n return actions_copy(text, {\n container: container\n });\n } // Defines which selection strategy based on `target` property.\n\n\n if (target) {\n return action === 'cut' ? actions_cut(target) : actions_copy(target, {\n container: container\n });\n }\n};\n\n/* harmony default export */ var actions_default = (ClipboardActionDefault);\n;// CONCATENATED MODULE: ./src/clipboard.js\nfunction clipboard_typeof(obj) { \"@babel/helpers - typeof\"; if (typeof Symbol === \"function\" && typeof Symbol.iterator === \"symbol\") { clipboard_typeof = function _typeof(obj) { return typeof obj; }; } else { clipboard_typeof = function _typeof(obj) { return obj && typeof Symbol === \"function\" && obj.constructor === Symbol && obj !== Symbol.prototype ? \"symbol\" : typeof obj; }; } return clipboard_typeof(obj); }\n\nfunction _classCallCheck(instance, Constructor) { if (!(instance instanceof Constructor)) { throw new TypeError(\"Cannot call a class as a function\"); } }\n\nfunction _defineProperties(target, props) { for (var i = 0; i < props.length; i++) { var descriptor = props[i]; descriptor.enumerable = descriptor.enumerable || false; descriptor.configurable = true; if (\"value\" in descriptor) descriptor.writable = true; Object.defineProperty(target, descriptor.key, descriptor); } }\n\nfunction _createClass(Constructor, protoProps, staticProps) { if (protoProps) _defineProperties(Constructor.prototype, protoProps); if (staticProps) _defineProperties(Constructor, staticProps); return Constructor; }\n\nfunction _inherits(subClass, superClass) { if (typeof superClass !== \"function\" && superClass !== null) { throw new TypeError(\"Super expression must either be null or a function\"); } subClass.prototype = Object.create(superClass && superClass.prototype, { constructor: { value: subClass, writable: true, configurable: true } }); if (superClass) _setPrototypeOf(subClass, superClass); }\n\nfunction _setPrototypeOf(o, p) { _setPrototypeOf = Object.setPrototypeOf || function _setPrototypeOf(o, p) { o.__proto__ = p; return o; }; return _setPrototypeOf(o, p); }\n\nfunction _createSuper(Derived) { var hasNativeReflectConstruct = _isNativeReflectConstruct(); return function _createSuperInternal() { var Super = _getPrototypeOf(Derived), result; if (hasNativeReflectConstruct) { var NewTarget = _getPrototypeOf(this).constructor; result = Reflect.construct(Super, arguments, NewTarget); } else { result = Super.apply(this, arguments); } return _possibleConstructorReturn(this, result); }; }\n\nfunction _possibleConstructorReturn(self, call) { if (call && (clipboard_typeof(call) === \"object\" || typeof call === \"function\")) { return call; } return _assertThisInitialized(self); }\n\nfunction _assertThisInitialized(self) { if (self === void 0) { throw new ReferenceError(\"this hasn't been initialised - super() hasn't been called\"); } return self; }\n\nfunction _isNativeReflectConstruct() { if (typeof Reflect === \"undefined\" || !Reflect.construct) return false; if (Reflect.construct.sham) return false; if (typeof Proxy === \"function\") return true; try { Date.prototype.toString.call(Reflect.construct(Date, [], function () {})); return true; } catch (e) { return false; } }\n\nfunction _getPrototypeOf(o) { _getPrototypeOf = Object.setPrototypeOf ? Object.getPrototypeOf : function _getPrototypeOf(o) { return o.__proto__ || Object.getPrototypeOf(o); }; return _getPrototypeOf(o); }\n\n\n\n\n\n\n/**\n * Helper function to retrieve attribute value.\n * @param {String} suffix\n * @param {Element} element\n */\n\nfunction getAttributeValue(suffix, element) {\n var attribute = \"data-clipboard-\".concat(suffix);\n\n if (!element.hasAttribute(attribute)) {\n return;\n }\n\n return element.getAttribute(attribute);\n}\n/**\n * Base class which takes one or more elements, adds event listeners to them,\n * and instantiates a new `ClipboardAction` on each click.\n */\n\n\nvar Clipboard = /*#__PURE__*/function (_Emitter) {\n _inherits(Clipboard, _Emitter);\n\n var _super = _createSuper(Clipboard);\n\n /**\n * @param {String|HTMLElement|HTMLCollection|NodeList} trigger\n * @param {Object} options\n */\n function Clipboard(trigger, options) {\n var _this;\n\n _classCallCheck(this, Clipboard);\n\n _this = _super.call(this);\n\n _this.resolveOptions(options);\n\n _this.listenClick(trigger);\n\n return _this;\n }\n /**\n * Defines if attributes would be resolved using internal setter functions\n * or custom functions that were passed in the constructor.\n * @param {Object} options\n */\n\n\n _createClass(Clipboard, [{\n key: \"resolveOptions\",\n value: function resolveOptions() {\n var options = arguments.length > 0 && arguments[0] !== undefined ? arguments[0] : {};\n this.action = typeof options.action === 'function' ? options.action : this.defaultAction;\n this.target = typeof options.target === 'function' ? options.target : this.defaultTarget;\n this.text = typeof options.text === 'function' ? options.text : this.defaultText;\n this.container = clipboard_typeof(options.container) === 'object' ? options.container : document.body;\n }\n /**\n * Adds a click event listener to the passed trigger.\n * @param {String|HTMLElement|HTMLCollection|NodeList} trigger\n */\n\n }, {\n key: \"listenClick\",\n value: function listenClick(trigger) {\n var _this2 = this;\n\n this.listener = listen_default()(trigger, 'click', function (e) {\n return _this2.onClick(e);\n });\n }\n /**\n * Defines a new `ClipboardAction` on each click event.\n * @param {Event} e\n */\n\n }, {\n key: \"onClick\",\n value: function onClick(e) {\n var trigger = e.delegateTarget || e.currentTarget;\n var action = this.action(trigger) || 'copy';\n var text = actions_default({\n action: action,\n container: this.container,\n target: this.target(trigger),\n text: this.text(trigger)\n }); // Fires an event based on the copy operation result.\n\n this.emit(text ? 'success' : 'error', {\n action: action,\n text: text,\n trigger: trigger,\n clearSelection: function clearSelection() {\n if (trigger) {\n trigger.focus();\n }\n\n window.getSelection().removeAllRanges();\n }\n });\n }\n /**\n * Default `action` lookup function.\n * @param {Element} trigger\n */\n\n }, {\n key: \"defaultAction\",\n value: function defaultAction(trigger) {\n return getAttributeValue('action', trigger);\n }\n /**\n * Default `target` lookup function.\n * @param {Element} trigger\n */\n\n }, {\n key: \"defaultTarget\",\n value: function defaultTarget(trigger) {\n var selector = getAttributeValue('target', trigger);\n\n if (selector) {\n return document.querySelector(selector);\n }\n }\n /**\n * Allow fire programmatically a copy action\n * @param {String|HTMLElement} target\n * @param {Object} options\n * @returns Text copied.\n */\n\n }, {\n key: \"defaultText\",\n\n /**\n * Default `text` lookup function.\n * @param {Element} trigger\n */\n value: function defaultText(trigger) {\n return getAttributeValue('text', trigger);\n }\n /**\n * Destroy lifecycle.\n */\n\n }, {\n key: \"destroy\",\n value: function destroy() {\n this.listener.destroy();\n }\n }], [{\n key: \"copy\",\n value: function copy(target) {\n var options = arguments.length > 1 && arguments[1] !== undefined ? arguments[1] : {\n container: document.body\n };\n return actions_copy(target, options);\n }\n /**\n * Allow fire programmatically a cut action\n * @param {String|HTMLElement} target\n * @returns Text cutted.\n */\n\n }, {\n key: \"cut\",\n value: function cut(target) {\n return actions_cut(target);\n }\n /**\n * Returns the support of the given action, or all actions if no action is\n * given.\n * @param {String} [action]\n */\n\n }, {\n key: \"isSupported\",\n value: function isSupported() {\n var action = arguments.length > 0 && arguments[0] !== undefined ? arguments[0] : ['copy', 'cut'];\n var actions = typeof action === 'string' ? [action] : action;\n var support = !!document.queryCommandSupported;\n actions.forEach(function (action) {\n support = support && !!document.queryCommandSupported(action);\n });\n return support;\n }\n }]);\n\n return Clipboard;\n}((tiny_emitter_default()));\n\n/* harmony default export */ var clipboard = (Clipboard);\n\n/***/ }),\n\n/***/ 828:\n/***/ (function(module) {\n\nvar DOCUMENT_NODE_TYPE = 9;\n\n/**\n * A polyfill for Element.matches()\n */\nif (typeof Element !== 'undefined' && !Element.prototype.matches) {\n var proto = Element.prototype;\n\n proto.matches = proto.matchesSelector ||\n proto.mozMatchesSelector ||\n proto.msMatchesSelector ||\n proto.oMatchesSelector ||\n proto.webkitMatchesSelector;\n}\n\n/**\n * Finds the closest parent that matches a selector.\n *\n * @param {Element} element\n * @param {String} selector\n * @return {Function}\n */\nfunction closest (element, selector) {\n while (element && element.nodeType !== DOCUMENT_NODE_TYPE) {\n if (typeof element.matches === 'function' &&\n element.matches(selector)) {\n return element;\n }\n element = element.parentNode;\n }\n}\n\nmodule.exports = closest;\n\n\n/***/ }),\n\n/***/ 438:\n/***/ (function(module, __unused_webpack_exports, __webpack_require__) {\n\nvar closest = __webpack_require__(828);\n\n/**\n * Delegates event to a selector.\n *\n * @param {Element} element\n * @param {String} selector\n * @param {String} type\n * @param {Function} callback\n * @param {Boolean} useCapture\n * @return {Object}\n */\nfunction _delegate(element, selector, type, callback, useCapture) {\n var listenerFn = listener.apply(this, arguments);\n\n element.addEventListener(type, listenerFn, useCapture);\n\n return {\n destroy: function() {\n element.removeEventListener(type, listenerFn, useCapture);\n }\n }\n}\n\n/**\n * Delegates event to a selector.\n *\n * @param {Element|String|Array} [elements]\n * @param {String} selector\n * @param {String} type\n * @param {Function} callback\n * @param {Boolean} useCapture\n * @return {Object}\n */\nfunction delegate(elements, selector, type, callback, useCapture) {\n // Handle the regular Element usage\n if (typeof elements.addEventListener === 'function') {\n return _delegate.apply(null, arguments);\n }\n\n // Handle Element-less usage, it defaults to global delegation\n if (typeof type === 'function') {\n // Use `document` as the first parameter, then apply arguments\n // This is a short way to .unshift `arguments` without running into deoptimizations\n return _delegate.bind(null, document).apply(null, arguments);\n }\n\n // Handle Selector-based usage\n if (typeof elements === 'string') {\n elements = document.querySelectorAll(elements);\n }\n\n // Handle Array-like based usage\n return Array.prototype.map.call(elements, function (element) {\n return _delegate(element, selector, type, callback, useCapture);\n });\n}\n\n/**\n * Finds closest match and invokes callback.\n *\n * @param {Element} element\n * @param {String} selector\n * @param {String} type\n * @param {Function} callback\n * @return {Function}\n */\nfunction listener(element, selector, type, callback) {\n return function(e) {\n e.delegateTarget = closest(e.target, selector);\n\n if (e.delegateTarget) {\n callback.call(element, e);\n }\n }\n}\n\nmodule.exports = delegate;\n\n\n/***/ }),\n\n/***/ 879:\n/***/ (function(__unused_webpack_module, exports) {\n\n/**\n * Check if argument is a HTML element.\n *\n * @param {Object} value\n * @return {Boolean}\n */\nexports.node = function(value) {\n return value !== undefined\n && value instanceof HTMLElement\n && value.nodeType === 1;\n};\n\n/**\n * Check if argument is a list of HTML elements.\n *\n * @param {Object} value\n * @return {Boolean}\n */\nexports.nodeList = function(value) {\n var type = Object.prototype.toString.call(value);\n\n return value !== undefined\n && (type === '[object NodeList]' || type === '[object HTMLCollection]')\n && ('length' in value)\n && (value.length === 0 || exports.node(value[0]));\n};\n\n/**\n * Check if argument is a string.\n *\n * @param {Object} value\n * @return {Boolean}\n */\nexports.string = function(value) {\n return typeof value === 'string'\n || value instanceof String;\n};\n\n/**\n * Check if argument is a function.\n *\n * @param {Object} value\n * @return {Boolean}\n */\nexports.fn = function(value) {\n var type = Object.prototype.toString.call(value);\n\n return type === '[object Function]';\n};\n\n\n/***/ }),\n\n/***/ 370:\n/***/ (function(module, __unused_webpack_exports, __webpack_require__) {\n\nvar is = __webpack_require__(879);\nvar delegate = __webpack_require__(438);\n\n/**\n * Validates all params and calls the right\n * listener function based on its target type.\n *\n * @param {String|HTMLElement|HTMLCollection|NodeList} target\n * @param {String} type\n * @param {Function} callback\n * @return {Object}\n */\nfunction listen(target, type, callback) {\n if (!target && !type && !callback) {\n throw new Error('Missing required arguments');\n }\n\n if (!is.string(type)) {\n throw new TypeError('Second argument must be a String');\n }\n\n if (!is.fn(callback)) {\n throw new TypeError('Third argument must be a Function');\n }\n\n if (is.node(target)) {\n return listenNode(target, type, callback);\n }\n else if (is.nodeList(target)) {\n return listenNodeList(target, type, callback);\n }\n else if (is.string(target)) {\n return listenSelector(target, type, callback);\n }\n else {\n throw new TypeError('First argument must be a String, HTMLElement, HTMLCollection, or NodeList');\n }\n}\n\n/**\n * Adds an event listener to a HTML element\n * and returns a remove listener function.\n *\n * @param {HTMLElement} node\n * @param {String} type\n * @param {Function} callback\n * @return {Object}\n */\nfunction listenNode(node, type, callback) {\n node.addEventListener(type, callback);\n\n return {\n destroy: function() {\n node.removeEventListener(type, callback);\n }\n }\n}\n\n/**\n * Add an event listener to a list of HTML elements\n * and returns a remove listener function.\n *\n * @param {NodeList|HTMLCollection} nodeList\n * @param {String} type\n * @param {Function} callback\n * @return {Object}\n */\nfunction listenNodeList(nodeList, type, callback) {\n Array.prototype.forEach.call(nodeList, function(node) {\n node.addEventListener(type, callback);\n });\n\n return {\n destroy: function() {\n Array.prototype.forEach.call(nodeList, function(node) {\n node.removeEventListener(type, callback);\n });\n }\n }\n}\n\n/**\n * Add an event listener to a selector\n * and returns a remove listener function.\n *\n * @param {String} selector\n * @param {String} type\n * @param {Function} callback\n * @return {Object}\n */\nfunction listenSelector(selector, type, callback) {\n return delegate(document.body, selector, type, callback);\n}\n\nmodule.exports = listen;\n\n\n/***/ }),\n\n/***/ 817:\n/***/ (function(module) {\n\nfunction select(element) {\n var selectedText;\n\n if (element.nodeName === 'SELECT') {\n element.focus();\n\n selectedText = element.value;\n }\n else if (element.nodeName === 'INPUT' || element.nodeName === 'TEXTAREA') {\n var isReadOnly = element.hasAttribute('readonly');\n\n if (!isReadOnly) {\n element.setAttribute('readonly', '');\n }\n\n element.select();\n element.setSelectionRange(0, element.value.length);\n\n if (!isReadOnly) {\n element.removeAttribute('readonly');\n }\n\n selectedText = element.value;\n }\n else {\n if (element.hasAttribute('contenteditable')) {\n element.focus();\n }\n\n var selection = window.getSelection();\n var range = document.createRange();\n\n range.selectNodeContents(element);\n selection.removeAllRanges();\n selection.addRange(range);\n\n selectedText = selection.toString();\n }\n\n return selectedText;\n}\n\nmodule.exports = select;\n\n\n/***/ }),\n\n/***/ 279:\n/***/ (function(module) {\n\nfunction E () {\n // Keep this empty so it's easier to inherit from\n // (via https://github.com/lipsmack from https://github.com/scottcorgan/tiny-emitter/issues/3)\n}\n\nE.prototype = {\n on: function (name, callback, ctx) {\n var e = this.e || (this.e = {});\n\n (e[name] || (e[name] = [])).push({\n fn: callback,\n ctx: ctx\n });\n\n return this;\n },\n\n once: function (name, callback, ctx) {\n var self = this;\n function listener () {\n self.off(name, listener);\n callback.apply(ctx, arguments);\n };\n\n listener._ = callback\n return this.on(name, listener, ctx);\n },\n\n emit: function (name) {\n var data = [].slice.call(arguments, 1);\n var evtArr = ((this.e || (this.e = {}))[name] || []).slice();\n var i = 0;\n var len = evtArr.length;\n\n for (i; i < len; i++) {\n evtArr[i].fn.apply(evtArr[i].ctx, data);\n }\n\n return this;\n },\n\n off: function (name, callback) {\n var e = this.e || (this.e = {});\n var evts = e[name];\n var liveEvents = [];\n\n if (evts && callback) {\n for (var i = 0, len = evts.length; i < len; i++) {\n if (evts[i].fn !== callback && evts[i].fn._ !== callback)\n liveEvents.push(evts[i]);\n }\n }\n\n // Remove event from queue to prevent memory leak\n // Suggested by https://github.com/lazd\n // Ref: https://github.com/scottcorgan/tiny-emitter/commit/c6ebfaa9bc973b33d110a84a307742b7cf94c953#commitcomment-5024910\n\n (liveEvents.length)\n ? e[name] = liveEvents\n : delete e[name];\n\n return this;\n }\n};\n\nmodule.exports = E;\nmodule.exports.TinyEmitter = E;\n\n\n/***/ })\n\n/******/ \t});\n/************************************************************************/\n/******/ \t// The module cache\n/******/ \tvar __webpack_module_cache__ = {};\n/******/ \t\n/******/ \t// The require function\n/******/ \tfunction __webpack_require__(moduleId) {\n/******/ \t\t// Check if module is in cache\n/******/ \t\tif(__webpack_module_cache__[moduleId]) {\n/******/ \t\t\treturn __webpack_module_cache__[moduleId].exports;\n/******/ \t\t}\n/******/ \t\t// Create a new module (and put it into the cache)\n/******/ \t\tvar module = __webpack_module_cache__[moduleId] = {\n/******/ \t\t\t// no module.id needed\n/******/ \t\t\t// no module.loaded needed\n/******/ \t\t\texports: {}\n/******/ \t\t};\n/******/ \t\n/******/ \t\t// Execute the module function\n/******/ \t\t__webpack_modules__[moduleId](module, module.exports, __webpack_require__);\n/******/ \t\n/******/ \t\t// Return the exports of the module\n/******/ \t\treturn module.exports;\n/******/ \t}\n/******/ \t\n/************************************************************************/\n/******/ \t/* webpack/runtime/compat get default export */\n/******/ \t!function() {\n/******/ \t\t// getDefaultExport function for compatibility with non-harmony modules\n/******/ \t\t__webpack_require__.n = function(module) {\n/******/ \t\t\tvar getter = module && module.__esModule ?\n/******/ \t\t\t\tfunction() { return module['default']; } :\n/******/ \t\t\t\tfunction() { return module; };\n/******/ \t\t\t__webpack_require__.d(getter, { a: getter });\n/******/ \t\t\treturn getter;\n/******/ \t\t};\n/******/ \t}();\n/******/ \t\n/******/ \t/* webpack/runtime/define property getters */\n/******/ \t!function() {\n/******/ \t\t// define getter functions for harmony exports\n/******/ \t\t__webpack_require__.d = function(exports, definition) {\n/******/ \t\t\tfor(var key in definition) {\n/******/ \t\t\t\tif(__webpack_require__.o(definition, key) && !__webpack_require__.o(exports, key)) {\n/******/ \t\t\t\t\tObject.defineProperty(exports, key, { enumerable: true, get: definition[key] });\n/******/ \t\t\t\t}\n/******/ \t\t\t}\n/******/ \t\t};\n/******/ \t}();\n/******/ \t\n/******/ \t/* webpack/runtime/hasOwnProperty shorthand */\n/******/ \t!function() {\n/******/ \t\t__webpack_require__.o = function(obj, prop) { return Object.prototype.hasOwnProperty.call(obj, prop); }\n/******/ \t}();\n/******/ \t\n/************************************************************************/\n/******/ \t// module exports must be returned from runtime so entry inlining is disabled\n/******/ \t// startup\n/******/ \t// Load entry module and return exports\n/******/ \treturn __webpack_require__(686);\n/******/ })()\n.default;\n});", "/*!\n * escape-html\n * Copyright(c) 2012-2013 TJ Holowaychuk\n * Copyright(c) 2015 Andreas Lubbe\n * Copyright(c) 2015 Tiancheng \"Timothy\" Gu\n * MIT Licensed\n */\n\n'use strict';\n\n/**\n * Module variables.\n * @private\n */\n\nvar matchHtmlRegExp = /[\"'&<>]/;\n\n/**\n * Module exports.\n * @public\n */\n\nmodule.exports = escapeHtml;\n\n/**\n * Escape special characters in the given string of html.\n *\n * @param {string} string The string to escape for inserting into HTML\n * @return {string}\n * @public\n */\n\nfunction escapeHtml(string) {\n var str = '' + string;\n var match = matchHtmlRegExp.exec(str);\n\n if (!match) {\n return str;\n }\n\n var escape;\n var html = '';\n var index = 0;\n var lastIndex = 0;\n\n for (index = match.index; index < str.length; index++) {\n switch (str.charCodeAt(index)) {\n case 34: // \"\n escape = '"';\n break;\n case 38: // &\n escape = '&';\n break;\n case 39: // '\n escape = ''';\n break;\n case 60: // <\n escape = '<';\n break;\n case 62: // >\n escape = '>';\n break;\n default:\n continue;\n }\n\n if (lastIndex !== index) {\n html += str.substring(lastIndex, index);\n }\n\n lastIndex = index + 1;\n html += escape;\n }\n\n return lastIndex !== index\n ? html + str.substring(lastIndex, index)\n : html;\n}\n", "/*\n * Copyright (c) 2016-2024 Martin Donath \n *\n * Permission is hereby granted, free of charge, to any person obtaining a copy\n * of this software and associated documentation files (the \"Software\"), to\n * deal in the Software without restriction, including without limitation the\n * rights to use, copy, modify, merge, publish, distribute, sublicense, and/or\n * sell copies of the Software, and to permit persons to whom the Software is\n * furnished to do so, subject to the following conditions:\n *\n * The above copyright notice and this permission notice shall be included in\n * all copies or substantial portions of the Software.\n *\n * THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR\n * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,\n * FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. IN NO EVENT SHALL THE\n * AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER\n * LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING\n * FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS\n * IN THE SOFTWARE.\n */\n\nimport \"focus-visible\"\n\nimport {\n EMPTY,\n NEVER,\n Observable,\n Subject,\n defer,\n delay,\n filter,\n map,\n merge,\n mergeWith,\n shareReplay,\n switchMap\n} from \"rxjs\"\n\nimport { configuration, feature } from \"./_\"\nimport {\n at,\n getActiveElement,\n getOptionalElement,\n requestJSON,\n setLocation,\n setToggle,\n watchDocument,\n watchKeyboard,\n watchLocation,\n watchLocationTarget,\n watchMedia,\n watchPrint,\n watchScript,\n watchViewport\n} from \"./browser\"\nimport {\n getComponentElement,\n getComponentElements,\n mountAnnounce,\n mountBackToTop,\n mountConsent,\n mountContent,\n mountDialog,\n mountHeader,\n mountHeaderTitle,\n mountPalette,\n mountProgress,\n mountSearch,\n mountSearchHiglight,\n mountSidebar,\n mountSource,\n mountTableOfContents,\n mountTabs,\n watchHeader,\n watchMain\n} from \"./components\"\nimport {\n SearchIndex,\n setupClipboardJS,\n setupInstantNavigation,\n setupVersionSelector\n} from \"./integrations\"\nimport {\n patchEllipsis,\n patchIndeterminate,\n patchScrollfix,\n patchScrolllock\n} from \"./patches\"\nimport \"./polyfills\"\n\n/* ----------------------------------------------------------------------------\n * Functions - @todo refactor\n * ------------------------------------------------------------------------- */\n\n/**\n * Fetch search index\n *\n * @returns Search index observable\n */\nfunction fetchSearchIndex(): Observable {\n if (location.protocol === \"file:\") {\n return watchScript(\n `${new URL(\"search/search_index.js\", config.base)}`\n )\n .pipe(\n // @ts-ignore - @todo fix typings\n map(() => __index),\n shareReplay(1)\n )\n } else {\n return requestJSON(\n new URL(\"search/search_index.json\", config.base)\n )\n }\n}\n\n/* ----------------------------------------------------------------------------\n * Application\n * ------------------------------------------------------------------------- */\n\n/* Yay, JavaScript is available */\ndocument.documentElement.classList.remove(\"no-js\")\ndocument.documentElement.classList.add(\"js\")\n\n/* Set up navigation observables and subjects */\nconst document$ = watchDocument()\nconst location$ = watchLocation()\nconst target$ = watchLocationTarget(location$)\nconst keyboard$ = watchKeyboard()\n\n/* Set up media observables */\nconst viewport$ = watchViewport()\nconst tablet$ = watchMedia(\"(min-width: 960px)\")\nconst screen$ = watchMedia(\"(min-width: 1220px)\")\nconst print$ = watchPrint()\n\n/* Retrieve search index, if search is enabled */\nconst config = configuration()\nconst index$ = document.forms.namedItem(\"search\")\n ? fetchSearchIndex()\n : NEVER\n\n/* Set up Clipboard.js integration */\nconst alert$ = new Subject()\nsetupClipboardJS({ alert$ })\n\n/* Set up progress indicator */\nconst progress$ = new Subject()\n\n/* Set up instant navigation, if enabled */\nif (feature(\"navigation.instant\"))\n setupInstantNavigation({ location$, viewport$, progress$ })\n .subscribe(document$)\n\n/* Set up version selector */\nif (config.version?.provider === \"mike\")\n setupVersionSelector({ document$ })\n\n/* Always close drawer and search on navigation */\nmerge(location$, target$)\n .pipe(\n delay(125)\n )\n .subscribe(() => {\n setToggle(\"drawer\", false)\n setToggle(\"search\", false)\n })\n\n/* Set up global keyboard handlers */\nkeyboard$\n .pipe(\n filter(({ mode }) => mode === \"global\")\n )\n .subscribe(key => {\n switch (key.type) {\n\n /* Go to previous page */\n case \"p\":\n case \",\":\n const prev = getOptionalElement(\"link[rel=prev]\")\n if (typeof prev !== \"undefined\")\n setLocation(prev)\n break\n\n /* Go to next page */\n case \"n\":\n case \".\":\n const next = getOptionalElement(\"link[rel=next]\")\n if (typeof next !== \"undefined\")\n setLocation(next)\n break\n\n /* Expand navigation, see https://bit.ly/3ZjG5io */\n case \"Enter\":\n const active = getActiveElement()\n if (active instanceof HTMLLabelElement)\n active.click()\n }\n })\n\n/* Set up patches */\npatchEllipsis({ viewport$, document$ })\npatchIndeterminate({ document$, tablet$ })\npatchScrollfix({ document$ })\npatchScrolllock({ viewport$, tablet$ })\n\n/* Set up header and main area observable */\nconst header$ = watchHeader(getComponentElement(\"header\"), { viewport$ })\nconst main$ = document$\n .pipe(\n map(() => getComponentElement(\"main\")),\n switchMap(el => watchMain(el, { viewport$, header$ })),\n shareReplay(1)\n )\n\n/* Set up control component observables */\nconst control$ = merge(\n\n /* Consent */\n ...getComponentElements(\"consent\")\n .map(el => mountConsent(el, { target$ })),\n\n /* Dialog */\n ...getComponentElements(\"dialog\")\n .map(el => mountDialog(el, { alert$ })),\n\n /* Header */\n ...getComponentElements(\"header\")\n .map(el => mountHeader(el, { viewport$, header$, main$ })),\n\n /* Color palette */\n ...getComponentElements(\"palette\")\n .map(el => mountPalette(el)),\n\n /* Progress bar */\n ...getComponentElements(\"progress\")\n .map(el => mountProgress(el, { progress$ })),\n\n /* Search */\n ...getComponentElements(\"search\")\n .map(el => mountSearch(el, { index$, keyboard$ })),\n\n /* Repository information */\n ...getComponentElements(\"source\")\n .map(el => mountSource(el))\n)\n\n/* Set up content component observables */\nconst content$ = defer(() => merge(\n\n /* Announcement bar */\n ...getComponentElements(\"announce\")\n .map(el => mountAnnounce(el)),\n\n /* Content */\n ...getComponentElements(\"content\")\n .map(el => mountContent(el, { viewport$, target$, print$ })),\n\n /* Search highlighting */\n ...getComponentElements(\"content\")\n .map(el => feature(\"search.highlight\")\n ? mountSearchHiglight(el, { index$, location$ })\n : EMPTY\n ),\n\n /* Header title */\n ...getComponentElements(\"header-title\")\n .map(el => mountHeaderTitle(el, { viewport$, header$ })),\n\n /* Sidebar */\n ...getComponentElements(\"sidebar\")\n .map(el => el.getAttribute(\"data-md-type\") === \"navigation\"\n ? at(screen$, () => mountSidebar(el, { viewport$, header$, main$ }))\n : at(tablet$, () => mountSidebar(el, { viewport$, header$, main$ }))\n ),\n\n /* Navigation tabs */\n ...getComponentElements(\"tabs\")\n .map(el => mountTabs(el, { viewport$, header$ })),\n\n /* Table of contents */\n ...getComponentElements(\"toc\")\n .map(el => mountTableOfContents(el, {\n viewport$, header$, main$, target$\n })),\n\n /* Back-to-top button */\n ...getComponentElements(\"top\")\n .map(el => mountBackToTop(el, { viewport$, header$, main$, target$ }))\n))\n\n/* Set up component observables */\nconst component$ = document$\n .pipe(\n switchMap(() => content$),\n mergeWith(control$),\n shareReplay(1)\n )\n\n/* Subscribe to all components */\ncomponent$.subscribe()\n\n/* ----------------------------------------------------------------------------\n * Exports\n * ------------------------------------------------------------------------- */\n\nwindow.document$ = document$ /* Document observable */\nwindow.location$ = location$ /* Location subject */\nwindow.target$ = target$ /* Location target observable */\nwindow.keyboard$ = keyboard$ /* Keyboard observable */\nwindow.viewport$ = viewport$ /* Viewport observable */\nwindow.tablet$ = tablet$ /* Media tablet observable */\nwindow.screen$ = screen$ /* Media screen observable */\nwindow.print$ = print$ /* Media print observable */\nwindow.alert$ = alert$ /* Alert subject */\nwindow.progress$ = progress$ /* Progress indicator subject */\nwindow.component$ = component$ /* Component observable */\n", "/*! *****************************************************************************\r\nCopyright (c) Microsoft Corporation.\r\n\r\nPermission to use, copy, modify, and/or distribute this software for any\r\npurpose with or without fee is hereby granted.\r\n\r\nTHE SOFTWARE IS PROVIDED \"AS IS\" AND THE AUTHOR DISCLAIMS ALL WARRANTIES WITH\r\nREGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY\r\nAND FITNESS. IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY SPECIAL, DIRECT,\r\nINDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM\r\nLOSS OF USE, DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR\r\nOTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR\r\nPERFORMANCE OF THIS SOFTWARE.\r\n***************************************************************************** */\r\n/* global Reflect, Promise */\r\n\r\nvar extendStatics = function(d, b) {\r\n extendStatics = Object.setPrototypeOf ||\r\n ({ __proto__: [] } instanceof Array && function (d, b) { d.__proto__ = b; }) ||\r\n function (d, b) { for (var p in b) if (Object.prototype.hasOwnProperty.call(b, p)) d[p] = b[p]; };\r\n return extendStatics(d, b);\r\n};\r\n\r\nexport function __extends(d, b) {\r\n if (typeof b !== \"function\" && b !== null)\r\n throw new TypeError(\"Class extends value \" + String(b) + \" is not a constructor or null\");\r\n extendStatics(d, b);\r\n function __() { this.constructor = d; }\r\n d.prototype = b === null ? Object.create(b) : (__.prototype = b.prototype, new __());\r\n}\r\n\r\nexport var __assign = function() {\r\n __assign = Object.assign || function __assign(t) {\r\n for (var s, i = 1, n = arguments.length; i < n; i++) {\r\n s = arguments[i];\r\n for (var p in s) if (Object.prototype.hasOwnProperty.call(s, p)) t[p] = s[p];\r\n }\r\n return t;\r\n }\r\n return __assign.apply(this, arguments);\r\n}\r\n\r\nexport function __rest(s, e) {\r\n var t = {};\r\n for (var p in s) if (Object.prototype.hasOwnProperty.call(s, p) && e.indexOf(p) < 0)\r\n t[p] = s[p];\r\n if (s != null && typeof Object.getOwnPropertySymbols === \"function\")\r\n for (var i = 0, p = Object.getOwnPropertySymbols(s); i < p.length; i++) {\r\n if (e.indexOf(p[i]) < 0 && Object.prototype.propertyIsEnumerable.call(s, p[i]))\r\n t[p[i]] = s[p[i]];\r\n }\r\n return t;\r\n}\r\n\r\nexport function __decorate(decorators, target, key, desc) {\r\n var c = arguments.length, r = c < 3 ? target : desc === null ? desc = Object.getOwnPropertyDescriptor(target, key) : desc, d;\r\n if (typeof Reflect === \"object\" && typeof Reflect.decorate === \"function\") r = Reflect.decorate(decorators, target, key, desc);\r\n else for (var i = decorators.length - 1; i >= 0; i--) if (d = decorators[i]) r = (c < 3 ? d(r) : c > 3 ? d(target, key, r) : d(target, key)) || r;\r\n return c > 3 && r && Object.defineProperty(target, key, r), r;\r\n}\r\n\r\nexport function __param(paramIndex, decorator) {\r\n return function (target, key) { decorator(target, key, paramIndex); }\r\n}\r\n\r\nexport function __metadata(metadataKey, metadataValue) {\r\n if (typeof Reflect === \"object\" && typeof Reflect.metadata === \"function\") return Reflect.metadata(metadataKey, metadataValue);\r\n}\r\n\r\nexport function __awaiter(thisArg, _arguments, P, generator) {\r\n function adopt(value) { return value instanceof P ? value : new P(function (resolve) { resolve(value); }); }\r\n return new (P || (P = Promise))(function (resolve, reject) {\r\n function fulfilled(value) { try { step(generator.next(value)); } catch (e) { reject(e); } }\r\n function rejected(value) { try { step(generator[\"throw\"](value)); } catch (e) { reject(e); } }\r\n function step(result) { result.done ? resolve(result.value) : adopt(result.value).then(fulfilled, rejected); }\r\n step((generator = generator.apply(thisArg, _arguments || [])).next());\r\n });\r\n}\r\n\r\nexport function __generator(thisArg, body) {\r\n var _ = { label: 0, sent: function() { if (t[0] & 1) throw t[1]; return t[1]; }, trys: [], ops: [] }, f, y, t, g;\r\n return g = { next: verb(0), \"throw\": verb(1), \"return\": verb(2) }, typeof Symbol === \"function\" && (g[Symbol.iterator] = function() { return this; }), g;\r\n function verb(n) { return function (v) { return step([n, v]); }; }\r\n function step(op) {\r\n if (f) throw new TypeError(\"Generator is already executing.\");\r\n while (_) try {\r\n if (f = 1, y && (t = op[0] & 2 ? y[\"return\"] : op[0] ? y[\"throw\"] || ((t = y[\"return\"]) && t.call(y), 0) : y.next) && !(t = t.call(y, op[1])).done) return t;\r\n if (y = 0, t) op = [op[0] & 2, t.value];\r\n switch (op[0]) {\r\n case 0: case 1: t = op; break;\r\n case 4: _.label++; return { value: op[1], done: false };\r\n case 5: _.label++; y = op[1]; op = [0]; continue;\r\n case 7: op = _.ops.pop(); _.trys.pop(); continue;\r\n default:\r\n if (!(t = _.trys, t = t.length > 0 && t[t.length - 1]) && (op[0] === 6 || op[0] === 2)) { _ = 0; continue; }\r\n if (op[0] === 3 && (!t || (op[1] > t[0] && op[1] < t[3]))) { _.label = op[1]; break; }\r\n if (op[0] === 6 && _.label < t[1]) { _.label = t[1]; t = op; break; }\r\n if (t && _.label < t[2]) { _.label = t[2]; _.ops.push(op); break; }\r\n if (t[2]) _.ops.pop();\r\n _.trys.pop(); continue;\r\n }\r\n op = body.call(thisArg, _);\r\n } catch (e) { op = [6, e]; y = 0; } finally { f = t = 0; }\r\n if (op[0] & 5) throw op[1]; return { value: op[0] ? op[1] : void 0, done: true };\r\n }\r\n}\r\n\r\nexport var __createBinding = Object.create ? (function(o, m, k, k2) {\r\n if (k2 === undefined) k2 = k;\r\n Object.defineProperty(o, k2, { enumerable: true, get: function() { return m[k]; } });\r\n}) : (function(o, m, k, k2) {\r\n if (k2 === undefined) k2 = k;\r\n o[k2] = m[k];\r\n});\r\n\r\nexport function __exportStar(m, o) {\r\n for (var p in m) if (p !== \"default\" && !Object.prototype.hasOwnProperty.call(o, p)) __createBinding(o, m, p);\r\n}\r\n\r\nexport function __values(o) {\r\n var s = typeof Symbol === \"function\" && Symbol.iterator, m = s && o[s], i = 0;\r\n if (m) return m.call(o);\r\n if (o && typeof o.length === \"number\") return {\r\n next: function () {\r\n if (o && i >= o.length) o = void 0;\r\n return { value: o && o[i++], done: !o };\r\n }\r\n };\r\n throw new TypeError(s ? \"Object is not iterable.\" : \"Symbol.iterator is not defined.\");\r\n}\r\n\r\nexport function __read(o, n) {\r\n var m = typeof Symbol === \"function\" && o[Symbol.iterator];\r\n if (!m) return o;\r\n var i = m.call(o), r, ar = [], e;\r\n try {\r\n while ((n === void 0 || n-- > 0) && !(r = i.next()).done) ar.push(r.value);\r\n }\r\n catch (error) { e = { error: error }; }\r\n finally {\r\n try {\r\n if (r && !r.done && (m = i[\"return\"])) m.call(i);\r\n }\r\n finally { if (e) throw e.error; }\r\n }\r\n return ar;\r\n}\r\n\r\n/** @deprecated */\r\nexport function __spread() {\r\n for (var ar = [], i = 0; i < arguments.length; i++)\r\n ar = ar.concat(__read(arguments[i]));\r\n return ar;\r\n}\r\n\r\n/** @deprecated */\r\nexport function __spreadArrays() {\r\n for (var s = 0, i = 0, il = arguments.length; i < il; i++) s += arguments[i].length;\r\n for (var r = Array(s), k = 0, i = 0; i < il; i++)\r\n for (var a = arguments[i], j = 0, jl = a.length; j < jl; j++, k++)\r\n r[k] = a[j];\r\n return r;\r\n}\r\n\r\nexport function __spreadArray(to, from, pack) {\r\n if (pack || arguments.length === 2) for (var i = 0, l = from.length, ar; i < l; i++) {\r\n if (ar || !(i in from)) {\r\n if (!ar) ar = Array.prototype.slice.call(from, 0, i);\r\n ar[i] = from[i];\r\n }\r\n }\r\n return to.concat(ar || Array.prototype.slice.call(from));\r\n}\r\n\r\nexport function __await(v) {\r\n return this instanceof __await ? (this.v = v, this) : new __await(v);\r\n}\r\n\r\nexport function __asyncGenerator(thisArg, _arguments, generator) {\r\n if (!Symbol.asyncIterator) throw new TypeError(\"Symbol.asyncIterator is not defined.\");\r\n var g = generator.apply(thisArg, _arguments || []), i, q = [];\r\n return i = {}, verb(\"next\"), verb(\"throw\"), verb(\"return\"), i[Symbol.asyncIterator] = function () { return this; }, i;\r\n function verb(n) { if (g[n]) i[n] = function (v) { return new Promise(function (a, b) { q.push([n, v, a, b]) > 1 || resume(n, v); }); }; }\r\n function resume(n, v) { try { step(g[n](v)); } catch (e) { settle(q[0][3], e); } }\r\n function step(r) { r.value instanceof __await ? Promise.resolve(r.value.v).then(fulfill, reject) : settle(q[0][2], r); }\r\n function fulfill(value) { resume(\"next\", value); }\r\n function reject(value) { resume(\"throw\", value); }\r\n function settle(f, v) { if (f(v), q.shift(), q.length) resume(q[0][0], q[0][1]); }\r\n}\r\n\r\nexport function __asyncDelegator(o) {\r\n var i, p;\r\n return i = {}, verb(\"next\"), verb(\"throw\", function (e) { throw e; }), verb(\"return\"), i[Symbol.iterator] = function () { return this; }, i;\r\n function verb(n, f) { i[n] = o[n] ? function (v) { return (p = !p) ? { value: __await(o[n](v)), done: n === \"return\" } : f ? f(v) : v; } : f; }\r\n}\r\n\r\nexport function __asyncValues(o) {\r\n if (!Symbol.asyncIterator) throw new TypeError(\"Symbol.asyncIterator is not defined.\");\r\n var m = o[Symbol.asyncIterator], i;\r\n return m ? m.call(o) : (o = typeof __values === \"function\" ? __values(o) : o[Symbol.iterator](), i = {}, verb(\"next\"), verb(\"throw\"), verb(\"return\"), i[Symbol.asyncIterator] = function () { return this; }, i);\r\n function verb(n) { i[n] = o[n] && function (v) { return new Promise(function (resolve, reject) { v = o[n](v), settle(resolve, reject, v.done, v.value); }); }; }\r\n function settle(resolve, reject, d, v) { Promise.resolve(v).then(function(v) { resolve({ value: v, done: d }); }, reject); }\r\n}\r\n\r\nexport function __makeTemplateObject(cooked, raw) {\r\n if (Object.defineProperty) { Object.defineProperty(cooked, \"raw\", { value: raw }); } else { cooked.raw = raw; }\r\n return cooked;\r\n};\r\n\r\nvar __setModuleDefault = Object.create ? (function(o, v) {\r\n Object.defineProperty(o, \"default\", { enumerable: true, value: v });\r\n}) : function(o, v) {\r\n o[\"default\"] = v;\r\n};\r\n\r\nexport function __importStar(mod) {\r\n if (mod && mod.__esModule) return mod;\r\n var result = {};\r\n if (mod != null) for (var k in mod) if (k !== \"default\" && Object.prototype.hasOwnProperty.call(mod, k)) __createBinding(result, mod, k);\r\n __setModuleDefault(result, mod);\r\n return result;\r\n}\r\n\r\nexport function __importDefault(mod) {\r\n return (mod && mod.__esModule) ? mod : { default: mod };\r\n}\r\n\r\nexport function __classPrivateFieldGet(receiver, state, kind, f) {\r\n if (kind === \"a\" && !f) throw new TypeError(\"Private accessor was defined without a getter\");\r\n if (typeof state === \"function\" ? receiver !== state || !f : !state.has(receiver)) throw new TypeError(\"Cannot read private member from an object whose class did not declare it\");\r\n return kind === \"m\" ? f : kind === \"a\" ? f.call(receiver) : f ? f.value : state.get(receiver);\r\n}\r\n\r\nexport function __classPrivateFieldSet(receiver, state, value, kind, f) {\r\n if (kind === \"m\") throw new TypeError(\"Private method is not writable\");\r\n if (kind === \"a\" && !f) throw new TypeError(\"Private accessor was defined without a setter\");\r\n if (typeof state === \"function\" ? receiver !== state || !f : !state.has(receiver)) throw new TypeError(\"Cannot write private member to an object whose class did not declare it\");\r\n return (kind === \"a\" ? f.call(receiver, value) : f ? f.value = value : state.set(receiver, value)), value;\r\n}\r\n", "/**\n * Returns true if the object is a function.\n * @param value The value to check\n */\nexport function isFunction(value: any): value is (...args: any[]) => any {\n return typeof value === 'function';\n}\n", "/**\n * Used to create Error subclasses until the community moves away from ES5.\n *\n * This is because compiling from TypeScript down to ES5 has issues with subclassing Errors\n * as well as other built-in types: https://github.com/Microsoft/TypeScript/issues/12123\n *\n * @param createImpl A factory function to create the actual constructor implementation. The returned\n * function should be a named function that calls `_super` internally.\n */\nexport function createErrorClass(createImpl: (_super: any) => any): T {\n const _super = (instance: any) => {\n Error.call(instance);\n instance.stack = new Error().stack;\n };\n\n const ctorFunc = createImpl(_super);\n ctorFunc.prototype = Object.create(Error.prototype);\n ctorFunc.prototype.constructor = ctorFunc;\n return ctorFunc;\n}\n", "import { createErrorClass } from './createErrorClass';\n\nexport interface UnsubscriptionError extends Error {\n readonly errors: any[];\n}\n\nexport interface UnsubscriptionErrorCtor {\n /**\n * @deprecated Internal implementation detail. Do not construct error instances.\n * Cannot be tagged as internal: https://github.com/ReactiveX/rxjs/issues/6269\n */\n new (errors: any[]): UnsubscriptionError;\n}\n\n/**\n * An error thrown when one or more errors have occurred during the\n * `unsubscribe` of a {@link Subscription}.\n */\nexport const UnsubscriptionError: UnsubscriptionErrorCtor = createErrorClass(\n (_super) =>\n function UnsubscriptionErrorImpl(this: any, errors: (Error | string)[]) {\n _super(this);\n this.message = errors\n ? `${errors.length} errors occurred during unsubscription:\n${errors.map((err, i) => `${i + 1}) ${err.toString()}`).join('\\n ')}`\n : '';\n this.name = 'UnsubscriptionError';\n this.errors = errors;\n }\n);\n", "/**\n * Removes an item from an array, mutating it.\n * @param arr The array to remove the item from\n * @param item The item to remove\n */\nexport function arrRemove(arr: T[] | undefined | null, item: T) {\n if (arr) {\n const index = arr.indexOf(item);\n 0 <= index && arr.splice(index, 1);\n }\n}\n", "import { isFunction } from './util/isFunction';\nimport { UnsubscriptionError } from './util/UnsubscriptionError';\nimport { SubscriptionLike, TeardownLogic, Unsubscribable } from './types';\nimport { arrRemove } from './util/arrRemove';\n\n/**\n * Represents a disposable resource, such as the execution of an Observable. A\n * Subscription has one important method, `unsubscribe`, that takes no argument\n * and just disposes the resource held by the subscription.\n *\n * Additionally, subscriptions may be grouped together through the `add()`\n * method, which will attach a child Subscription to the current Subscription.\n * When a Subscription is unsubscribed, all its children (and its grandchildren)\n * will be unsubscribed as well.\n *\n * @class Subscription\n */\nexport class Subscription implements SubscriptionLike {\n /** @nocollapse */\n public static EMPTY = (() => {\n const empty = new Subscription();\n empty.closed = true;\n return empty;\n })();\n\n /**\n * A flag to indicate whether this Subscription has already been unsubscribed.\n */\n public closed = false;\n\n private _parentage: Subscription[] | Subscription | null = null;\n\n /**\n * The list of registered finalizers to execute upon unsubscription. Adding and removing from this\n * list occurs in the {@link #add} and {@link #remove} methods.\n */\n private _finalizers: Exclude[] | null = null;\n\n /**\n * @param initialTeardown A function executed first as part of the finalization\n * process that is kicked off when {@link #unsubscribe} is called.\n */\n constructor(private initialTeardown?: () => void) {}\n\n /**\n * Disposes the resources held by the subscription. May, for instance, cancel\n * an ongoing Observable execution or cancel any other type of work that\n * started when the Subscription was created.\n * @return {void}\n */\n unsubscribe(): void {\n let errors: any[] | undefined;\n\n if (!this.closed) {\n this.closed = true;\n\n // Remove this from it's parents.\n const { _parentage } = this;\n if (_parentage) {\n this._parentage = null;\n if (Array.isArray(_parentage)) {\n for (const parent of _parentage) {\n parent.remove(this);\n }\n } else {\n _parentage.remove(this);\n }\n }\n\n const { initialTeardown: initialFinalizer } = this;\n if (isFunction(initialFinalizer)) {\n try {\n initialFinalizer();\n } catch (e) {\n errors = e instanceof UnsubscriptionError ? e.errors : [e];\n }\n }\n\n const { _finalizers } = this;\n if (_finalizers) {\n this._finalizers = null;\n for (const finalizer of _finalizers) {\n try {\n execFinalizer(finalizer);\n } catch (err) {\n errors = errors ?? [];\n if (err instanceof UnsubscriptionError) {\n errors = [...errors, ...err.errors];\n } else {\n errors.push(err);\n }\n }\n }\n }\n\n if (errors) {\n throw new UnsubscriptionError(errors);\n }\n }\n }\n\n /**\n * Adds a finalizer to this subscription, so that finalization will be unsubscribed/called\n * when this subscription is unsubscribed. If this subscription is already {@link #closed},\n * because it has already been unsubscribed, then whatever finalizer is passed to it\n * will automatically be executed (unless the finalizer itself is also a closed subscription).\n *\n * Closed Subscriptions cannot be added as finalizers to any subscription. Adding a closed\n * subscription to a any subscription will result in no operation. (A noop).\n *\n * Adding a subscription to itself, or adding `null` or `undefined` will not perform any\n * operation at all. (A noop).\n *\n * `Subscription` instances that are added to this instance will automatically remove themselves\n * if they are unsubscribed. Functions and {@link Unsubscribable} objects that you wish to remove\n * will need to be removed manually with {@link #remove}\n *\n * @param teardown The finalization logic to add to this subscription.\n */\n add(teardown: TeardownLogic): void {\n // Only add the finalizer if it's not undefined\n // and don't add a subscription to itself.\n if (teardown && teardown !== this) {\n if (this.closed) {\n // If this subscription is already closed,\n // execute whatever finalizer is handed to it automatically.\n execFinalizer(teardown);\n } else {\n if (teardown instanceof Subscription) {\n // We don't add closed subscriptions, and we don't add the same subscription\n // twice. Subscription unsubscribe is idempotent.\n if (teardown.closed || teardown._hasParent(this)) {\n return;\n }\n teardown._addParent(this);\n }\n (this._finalizers = this._finalizers ?? []).push(teardown);\n }\n }\n }\n\n /**\n * Checks to see if a this subscription already has a particular parent.\n * This will signal that this subscription has already been added to the parent in question.\n * @param parent the parent to check for\n */\n private _hasParent(parent: Subscription) {\n const { _parentage } = this;\n return _parentage === parent || (Array.isArray(_parentage) && _parentage.includes(parent));\n }\n\n /**\n * Adds a parent to this subscription so it can be removed from the parent if it\n * unsubscribes on it's own.\n *\n * NOTE: THIS ASSUMES THAT {@link _hasParent} HAS ALREADY BEEN CHECKED.\n * @param parent The parent subscription to add\n */\n private _addParent(parent: Subscription) {\n const { _parentage } = this;\n this._parentage = Array.isArray(_parentage) ? (_parentage.push(parent), _parentage) : _parentage ? [_parentage, parent] : parent;\n }\n\n /**\n * Called on a child when it is removed via {@link #remove}.\n * @param parent The parent to remove\n */\n private _removeParent(parent: Subscription) {\n const { _parentage } = this;\n if (_parentage === parent) {\n this._parentage = null;\n } else if (Array.isArray(_parentage)) {\n arrRemove(_parentage, parent);\n }\n }\n\n /**\n * Removes a finalizer from this subscription that was previously added with the {@link #add} method.\n *\n * Note that `Subscription` instances, when unsubscribed, will automatically remove themselves\n * from every other `Subscription` they have been added to. This means that using the `remove` method\n * is not a common thing and should be used thoughtfully.\n *\n * If you add the same finalizer instance of a function or an unsubscribable object to a `Subscription` instance\n * more than once, you will need to call `remove` the same number of times to remove all instances.\n *\n * All finalizer instances are removed to free up memory upon unsubscription.\n *\n * @param teardown The finalizer to remove from this subscription\n */\n remove(teardown: Exclude): void {\n const { _finalizers } = this;\n _finalizers && arrRemove(_finalizers, teardown);\n\n if (teardown instanceof Subscription) {\n teardown._removeParent(this);\n }\n }\n}\n\nexport const EMPTY_SUBSCRIPTION = Subscription.EMPTY;\n\nexport function isSubscription(value: any): value is Subscription {\n return (\n value instanceof Subscription ||\n (value && 'closed' in value && isFunction(value.remove) && isFunction(value.add) && isFunction(value.unsubscribe))\n );\n}\n\nfunction execFinalizer(finalizer: Unsubscribable | (() => void)) {\n if (isFunction(finalizer)) {\n finalizer();\n } else {\n finalizer.unsubscribe();\n }\n}\n", "import { Subscriber } from './Subscriber';\nimport { ObservableNotification } from './types';\n\n/**\n * The {@link GlobalConfig} object for RxJS. It is used to configure things\n * like how to react on unhandled errors.\n */\nexport const config: GlobalConfig = {\n onUnhandledError: null,\n onStoppedNotification: null,\n Promise: undefined,\n useDeprecatedSynchronousErrorHandling: false,\n useDeprecatedNextContext: false,\n};\n\n/**\n * The global configuration object for RxJS, used to configure things\n * like how to react on unhandled errors. Accessible via {@link config}\n * object.\n */\nexport interface GlobalConfig {\n /**\n * A registration point for unhandled errors from RxJS. These are errors that\n * cannot were not handled by consuming code in the usual subscription path. For\n * example, if you have this configured, and you subscribe to an observable without\n * providing an error handler, errors from that subscription will end up here. This\n * will _always_ be called asynchronously on another job in the runtime. This is because\n * we do not want errors thrown in this user-configured handler to interfere with the\n * behavior of the library.\n */\n onUnhandledError: ((err: any) => void) | null;\n\n /**\n * A registration point for notifications that cannot be sent to subscribers because they\n * have completed, errored or have been explicitly unsubscribed. By default, next, complete\n * and error notifications sent to stopped subscribers are noops. However, sometimes callers\n * might want a different behavior. For example, with sources that attempt to report errors\n * to stopped subscribers, a caller can configure RxJS to throw an unhandled error instead.\n * This will _always_ be called asynchronously on another job in the runtime. This is because\n * we do not want errors thrown in this user-configured handler to interfere with the\n * behavior of the library.\n */\n onStoppedNotification: ((notification: ObservableNotification, subscriber: Subscriber) => void) | null;\n\n /**\n * The promise constructor used by default for {@link Observable#toPromise toPromise} and {@link Observable#forEach forEach}\n * methods.\n *\n * @deprecated As of version 8, RxJS will no longer support this sort of injection of a\n * Promise constructor. If you need a Promise implementation other than native promises,\n * please polyfill/patch Promise as you see appropriate. Will be removed in v8.\n */\n Promise?: PromiseConstructorLike;\n\n /**\n * If true, turns on synchronous error rethrowing, which is a deprecated behavior\n * in v6 and higher. This behavior enables bad patterns like wrapping a subscribe\n * call in a try/catch block. It also enables producer interference, a nasty bug\n * where a multicast can be broken for all observers by a downstream consumer with\n * an unhandled error. DO NOT USE THIS FLAG UNLESS IT'S NEEDED TO BUY TIME\n * FOR MIGRATION REASONS.\n *\n * @deprecated As of version 8, RxJS will no longer support synchronous throwing\n * of unhandled errors. All errors will be thrown on a separate call stack to prevent bad\n * behaviors described above. Will be removed in v8.\n */\n useDeprecatedSynchronousErrorHandling: boolean;\n\n /**\n * If true, enables an as-of-yet undocumented feature from v5: The ability to access\n * `unsubscribe()` via `this` context in `next` functions created in observers passed\n * to `subscribe`.\n *\n * This is being removed because the performance was severely problematic, and it could also cause\n * issues when types other than POJOs are passed to subscribe as subscribers, as they will likely have\n * their `this` context overwritten.\n *\n * @deprecated As of version 8, RxJS will no longer support altering the\n * context of next functions provided as part of an observer to Subscribe. Instead,\n * you will have access to a subscription or a signal or token that will allow you to do things like\n * unsubscribe and test closed status. Will be removed in v8.\n */\n useDeprecatedNextContext: boolean;\n}\n", "import type { TimerHandle } from './timerHandle';\ntype SetTimeoutFunction = (handler: () => void, timeout?: number, ...args: any[]) => TimerHandle;\ntype ClearTimeoutFunction = (handle: TimerHandle) => void;\n\ninterface TimeoutProvider {\n setTimeout: SetTimeoutFunction;\n clearTimeout: ClearTimeoutFunction;\n delegate:\n | {\n setTimeout: SetTimeoutFunction;\n clearTimeout: ClearTimeoutFunction;\n }\n | undefined;\n}\n\nexport const timeoutProvider: TimeoutProvider = {\n // When accessing the delegate, use the variable rather than `this` so that\n // the functions can be called without being bound to the provider.\n setTimeout(handler: () => void, timeout?: number, ...args) {\n const { delegate } = timeoutProvider;\n if (delegate?.setTimeout) {\n return delegate.setTimeout(handler, timeout, ...args);\n }\n return setTimeout(handler, timeout, ...args);\n },\n clearTimeout(handle) {\n const { delegate } = timeoutProvider;\n return (delegate?.clearTimeout || clearTimeout)(handle as any);\n },\n delegate: undefined,\n};\n", "import { config } from '../config';\nimport { timeoutProvider } from '../scheduler/timeoutProvider';\n\n/**\n * Handles an error on another job either with the user-configured {@link onUnhandledError},\n * or by throwing it on that new job so it can be picked up by `window.onerror`, `process.on('error')`, etc.\n *\n * This should be called whenever there is an error that is out-of-band with the subscription\n * or when an error hits a terminal boundary of the subscription and no error handler was provided.\n *\n * @param err the error to report\n */\nexport function reportUnhandledError(err: any) {\n timeoutProvider.setTimeout(() => {\n const { onUnhandledError } = config;\n if (onUnhandledError) {\n // Execute the user-configured error handler.\n onUnhandledError(err);\n } else {\n // Throw so it is picked up by the runtime's uncaught error mechanism.\n throw err;\n }\n });\n}\n", "/* tslint:disable:no-empty */\nexport function noop() { }\n", "import { CompleteNotification, NextNotification, ErrorNotification } from './types';\n\n/**\n * A completion object optimized for memory use and created to be the\n * same \"shape\" as other notifications in v8.\n * @internal\n */\nexport const COMPLETE_NOTIFICATION = (() => createNotification('C', undefined, undefined) as CompleteNotification)();\n\n/**\n * Internal use only. Creates an optimized error notification that is the same \"shape\"\n * as other notifications.\n * @internal\n */\nexport function errorNotification(error: any): ErrorNotification {\n return createNotification('E', undefined, error) as any;\n}\n\n/**\n * Internal use only. Creates an optimized next notification that is the same \"shape\"\n * as other notifications.\n * @internal\n */\nexport function nextNotification(value: T) {\n return createNotification('N', value, undefined) as NextNotification;\n}\n\n/**\n * Ensures that all notifications created internally have the same \"shape\" in v8.\n *\n * TODO: This is only exported to support a crazy legacy test in `groupBy`.\n * @internal\n */\nexport function createNotification(kind: 'N' | 'E' | 'C', value: any, error: any) {\n return {\n kind,\n value,\n error,\n };\n}\n", "import { config } from '../config';\n\nlet context: { errorThrown: boolean; error: any } | null = null;\n\n/**\n * Handles dealing with errors for super-gross mode. Creates a context, in which\n * any synchronously thrown errors will be passed to {@link captureError}. Which\n * will record the error such that it will be rethrown after the call back is complete.\n * TODO: Remove in v8\n * @param cb An immediately executed function.\n */\nexport function errorContext(cb: () => void) {\n if (config.useDeprecatedSynchronousErrorHandling) {\n const isRoot = !context;\n if (isRoot) {\n context = { errorThrown: false, error: null };\n }\n cb();\n if (isRoot) {\n const { errorThrown, error } = context!;\n context = null;\n if (errorThrown) {\n throw error;\n }\n }\n } else {\n // This is the general non-deprecated path for everyone that\n // isn't crazy enough to use super-gross mode (useDeprecatedSynchronousErrorHandling)\n cb();\n }\n}\n\n/**\n * Captures errors only in super-gross mode.\n * @param err the error to capture\n */\nexport function captureError(err: any) {\n if (config.useDeprecatedSynchronousErrorHandling && context) {\n context.errorThrown = true;\n context.error = err;\n }\n}\n", "import { isFunction } from './util/isFunction';\nimport { Observer, ObservableNotification } from './types';\nimport { isSubscription, Subscription } from './Subscription';\nimport { config } from './config';\nimport { reportUnhandledError } from './util/reportUnhandledError';\nimport { noop } from './util/noop';\nimport { nextNotification, errorNotification, COMPLETE_NOTIFICATION } from './NotificationFactories';\nimport { timeoutProvider } from './scheduler/timeoutProvider';\nimport { captureError } from './util/errorContext';\n\n/**\n * Implements the {@link Observer} interface and extends the\n * {@link Subscription} class. While the {@link Observer} is the public API for\n * consuming the values of an {@link Observable}, all Observers get converted to\n * a Subscriber, in order to provide Subscription-like capabilities such as\n * `unsubscribe`. Subscriber is a common type in RxJS, and crucial for\n * implementing operators, but it is rarely used as a public API.\n *\n * @class Subscriber\n */\nexport class Subscriber extends Subscription implements Observer {\n /**\n * A static factory for a Subscriber, given a (potentially partial) definition\n * of an Observer.\n * @param next The `next` callback of an Observer.\n * @param error The `error` callback of an\n * Observer.\n * @param complete The `complete` callback of an\n * Observer.\n * @return A Subscriber wrapping the (partially defined)\n * Observer represented by the given arguments.\n * @nocollapse\n * @deprecated Do not use. Will be removed in v8. There is no replacement for this\n * method, and there is no reason to be creating instances of `Subscriber` directly.\n * If you have a specific use case, please file an issue.\n */\n static create(next?: (x?: T) => void, error?: (e?: any) => void, complete?: () => void): Subscriber {\n return new SafeSubscriber(next, error, complete);\n }\n\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n protected isStopped: boolean = false;\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n protected destination: Subscriber | Observer; // this `any` is the escape hatch to erase extra type param (e.g. R)\n\n /**\n * @deprecated Internal implementation detail, do not use directly. Will be made internal in v8.\n * There is no reason to directly create an instance of Subscriber. This type is exported for typings reasons.\n */\n constructor(destination?: Subscriber | Observer) {\n super();\n if (destination) {\n this.destination = destination;\n // Automatically chain subscriptions together here.\n // if destination is a Subscription, then it is a Subscriber.\n if (isSubscription(destination)) {\n destination.add(this);\n }\n } else {\n this.destination = EMPTY_OBSERVER;\n }\n }\n\n /**\n * The {@link Observer} callback to receive notifications of type `next` from\n * the Observable, with a value. The Observable may call this method 0 or more\n * times.\n * @param {T} [value] The `next` value.\n * @return {void}\n */\n next(value?: T): void {\n if (this.isStopped) {\n handleStoppedNotification(nextNotification(value), this);\n } else {\n this._next(value!);\n }\n }\n\n /**\n * The {@link Observer} callback to receive notifications of type `error` from\n * the Observable, with an attached `Error`. Notifies the Observer that\n * the Observable has experienced an error condition.\n * @param {any} [err] The `error` exception.\n * @return {void}\n */\n error(err?: any): void {\n if (this.isStopped) {\n handleStoppedNotification(errorNotification(err), this);\n } else {\n this.isStopped = true;\n this._error(err);\n }\n }\n\n /**\n * The {@link Observer} callback to receive a valueless notification of type\n * `complete` from the Observable. Notifies the Observer that the Observable\n * has finished sending push-based notifications.\n * @return {void}\n */\n complete(): void {\n if (this.isStopped) {\n handleStoppedNotification(COMPLETE_NOTIFICATION, this);\n } else {\n this.isStopped = true;\n this._complete();\n }\n }\n\n unsubscribe(): void {\n if (!this.closed) {\n this.isStopped = true;\n super.unsubscribe();\n this.destination = null!;\n }\n }\n\n protected _next(value: T): void {\n this.destination.next(value);\n }\n\n protected _error(err: any): void {\n try {\n this.destination.error(err);\n } finally {\n this.unsubscribe();\n }\n }\n\n protected _complete(): void {\n try {\n this.destination.complete();\n } finally {\n this.unsubscribe();\n }\n }\n}\n\n/**\n * This bind is captured here because we want to be able to have\n * compatibility with monoid libraries that tend to use a method named\n * `bind`. In particular, a library called Monio requires this.\n */\nconst _bind = Function.prototype.bind;\n\nfunction bind any>(fn: Fn, thisArg: any): Fn {\n return _bind.call(fn, thisArg);\n}\n\n/**\n * Internal optimization only, DO NOT EXPOSE.\n * @internal\n */\nclass ConsumerObserver implements Observer {\n constructor(private partialObserver: Partial>) {}\n\n next(value: T): void {\n const { partialObserver } = this;\n if (partialObserver.next) {\n try {\n partialObserver.next(value);\n } catch (error) {\n handleUnhandledError(error);\n }\n }\n }\n\n error(err: any): void {\n const { partialObserver } = this;\n if (partialObserver.error) {\n try {\n partialObserver.error(err);\n } catch (error) {\n handleUnhandledError(error);\n }\n } else {\n handleUnhandledError(err);\n }\n }\n\n complete(): void {\n const { partialObserver } = this;\n if (partialObserver.complete) {\n try {\n partialObserver.complete();\n } catch (error) {\n handleUnhandledError(error);\n }\n }\n }\n}\n\nexport class SafeSubscriber extends Subscriber {\n constructor(\n observerOrNext?: Partial> | ((value: T) => void) | null,\n error?: ((e?: any) => void) | null,\n complete?: (() => void) | null\n ) {\n super();\n\n let partialObserver: Partial>;\n if (isFunction(observerOrNext) || !observerOrNext) {\n // The first argument is a function, not an observer. The next\n // two arguments *could* be observers, or they could be empty.\n partialObserver = {\n next: (observerOrNext ?? undefined) as (((value: T) => void) | undefined),\n error: error ?? undefined,\n complete: complete ?? undefined,\n };\n } else {\n // The first argument is a partial observer.\n let context: any;\n if (this && config.useDeprecatedNextContext) {\n // This is a deprecated path that made `this.unsubscribe()` available in\n // next handler functions passed to subscribe. This only exists behind a flag\n // now, as it is *very* slow.\n context = Object.create(observerOrNext);\n context.unsubscribe = () => this.unsubscribe();\n partialObserver = {\n next: observerOrNext.next && bind(observerOrNext.next, context),\n error: observerOrNext.error && bind(observerOrNext.error, context),\n complete: observerOrNext.complete && bind(observerOrNext.complete, context),\n };\n } else {\n // The \"normal\" path. Just use the partial observer directly.\n partialObserver = observerOrNext;\n }\n }\n\n // Wrap the partial observer to ensure it's a full observer, and\n // make sure proper error handling is accounted for.\n this.destination = new ConsumerObserver(partialObserver);\n }\n}\n\nfunction handleUnhandledError(error: any) {\n if (config.useDeprecatedSynchronousErrorHandling) {\n captureError(error);\n } else {\n // Ideal path, we report this as an unhandled error,\n // which is thrown on a new call stack.\n reportUnhandledError(error);\n }\n}\n\n/**\n * An error handler used when no error handler was supplied\n * to the SafeSubscriber -- meaning no error handler was supplied\n * do the `subscribe` call on our observable.\n * @param err The error to handle\n */\nfunction defaultErrorHandler(err: any) {\n throw err;\n}\n\n/**\n * A handler for notifications that cannot be sent to a stopped subscriber.\n * @param notification The notification being sent\n * @param subscriber The stopped subscriber\n */\nfunction handleStoppedNotification(notification: ObservableNotification, subscriber: Subscriber) {\n const { onStoppedNotification } = config;\n onStoppedNotification && timeoutProvider.setTimeout(() => onStoppedNotification(notification, subscriber));\n}\n\n/**\n * The observer used as a stub for subscriptions where the user did not\n * pass any arguments to `subscribe`. Comes with the default error handling\n * behavior.\n */\nexport const EMPTY_OBSERVER: Readonly> & { closed: true } = {\n closed: true,\n next: noop,\n error: defaultErrorHandler,\n complete: noop,\n};\n", "/**\n * Symbol.observable or a string \"@@observable\". Used for interop\n *\n * @deprecated We will no longer be exporting this symbol in upcoming versions of RxJS.\n * Instead polyfill and use Symbol.observable directly *or* use https://www.npmjs.com/package/symbol-observable\n */\nexport const observable: string | symbol = (() => (typeof Symbol === 'function' && Symbol.observable) || '@@observable')();\n", "/**\n * This function takes one parameter and just returns it. Simply put,\n * this is like `(x: T): T => x`.\n *\n * ## Examples\n *\n * This is useful in some cases when using things like `mergeMap`\n *\n * ```ts\n * import { interval, take, map, range, mergeMap, identity } from 'rxjs';\n *\n * const source$ = interval(1000).pipe(take(5));\n *\n * const result$ = source$.pipe(\n * map(i => range(i)),\n * mergeMap(identity) // same as mergeMap(x => x)\n * );\n *\n * result$.subscribe({\n * next: console.log\n * });\n * ```\n *\n * Or when you want to selectively apply an operator\n *\n * ```ts\n * import { interval, take, identity } from 'rxjs';\n *\n * const shouldLimit = () => Math.random() < 0.5;\n *\n * const source$ = interval(1000);\n *\n * const result$ = source$.pipe(shouldLimit() ? take(5) : identity);\n *\n * result$.subscribe({\n * next: console.log\n * });\n * ```\n *\n * @param x Any value that is returned by this function\n * @returns The value passed as the first parameter to this function\n */\nexport function identity(x: T): T {\n return x;\n}\n", "import { identity } from './identity';\nimport { UnaryFunction } from '../types';\n\nexport function pipe(): typeof identity;\nexport function pipe(fn1: UnaryFunction): UnaryFunction;\nexport function pipe(fn1: UnaryFunction, fn2: UnaryFunction): UnaryFunction;\nexport function pipe(fn1: UnaryFunction, fn2: UnaryFunction, fn3: UnaryFunction): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction\n): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction,\n fn5: UnaryFunction\n): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction,\n fn5: UnaryFunction,\n fn6: UnaryFunction\n): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction,\n fn5: UnaryFunction,\n fn6: UnaryFunction,\n fn7: UnaryFunction\n): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction,\n fn5: UnaryFunction,\n fn6: UnaryFunction,\n fn7: UnaryFunction,\n fn8: UnaryFunction\n): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction,\n fn5: UnaryFunction,\n fn6: UnaryFunction,\n fn7: UnaryFunction,\n fn8: UnaryFunction,\n fn9: UnaryFunction\n): UnaryFunction;\nexport function pipe(\n fn1: UnaryFunction,\n fn2: UnaryFunction,\n fn3: UnaryFunction,\n fn4: UnaryFunction,\n fn5: UnaryFunction,\n fn6: UnaryFunction,\n fn7: UnaryFunction,\n fn8: UnaryFunction,\n fn9: UnaryFunction,\n ...fns: UnaryFunction[]\n): UnaryFunction;\n\n/**\n * pipe() can be called on one or more functions, each of which can take one argument (\"UnaryFunction\")\n * and uses it to return a value.\n * It returns a function that takes one argument, passes it to the first UnaryFunction, and then\n * passes the result to the next one, passes that result to the next one, and so on. \n */\nexport function pipe(...fns: Array>): UnaryFunction {\n return pipeFromArray(fns);\n}\n\n/** @internal */\nexport function pipeFromArray(fns: Array>): UnaryFunction {\n if (fns.length === 0) {\n return identity as UnaryFunction;\n }\n\n if (fns.length === 1) {\n return fns[0];\n }\n\n return function piped(input: T): R {\n return fns.reduce((prev: any, fn: UnaryFunction) => fn(prev), input as any);\n };\n}\n", "import { Operator } from './Operator';\nimport { SafeSubscriber, Subscriber } from './Subscriber';\nimport { isSubscription, Subscription } from './Subscription';\nimport { TeardownLogic, OperatorFunction, Subscribable, Observer } from './types';\nimport { observable as Symbol_observable } from './symbol/observable';\nimport { pipeFromArray } from './util/pipe';\nimport { config } from './config';\nimport { isFunction } from './util/isFunction';\nimport { errorContext } from './util/errorContext';\n\n/**\n * A representation of any set of values over any amount of time. This is the most basic building block\n * of RxJS.\n *\n * @class Observable\n */\nexport class Observable implements Subscribable {\n /**\n * @deprecated Internal implementation detail, do not use directly. Will be made internal in v8.\n */\n source: Observable | undefined;\n\n /**\n * @deprecated Internal implementation detail, do not use directly. Will be made internal in v8.\n */\n operator: Operator | undefined;\n\n /**\n * @constructor\n * @param {Function} subscribe the function that is called when the Observable is\n * initially subscribed to. This function is given a Subscriber, to which new values\n * can be `next`ed, or an `error` method can be called to raise an error, or\n * `complete` can be called to notify of a successful completion.\n */\n constructor(subscribe?: (this: Observable, subscriber: Subscriber) => TeardownLogic) {\n if (subscribe) {\n this._subscribe = subscribe;\n }\n }\n\n // HACK: Since TypeScript inherits static properties too, we have to\n // fight against TypeScript here so Subject can have a different static create signature\n /**\n * Creates a new Observable by calling the Observable constructor\n * @owner Observable\n * @method create\n * @param {Function} subscribe? the subscriber function to be passed to the Observable constructor\n * @return {Observable} a new observable\n * @nocollapse\n * @deprecated Use `new Observable()` instead. Will be removed in v8.\n */\n static create: (...args: any[]) => any = (subscribe?: (subscriber: Subscriber) => TeardownLogic) => {\n return new Observable(subscribe);\n };\n\n /**\n * Creates a new Observable, with this Observable instance as the source, and the passed\n * operator defined as the new observable's operator.\n * @method lift\n * @param operator the operator defining the operation to take on the observable\n * @return a new observable with the Operator applied\n * @deprecated Internal implementation detail, do not use directly. Will be made internal in v8.\n * If you have implemented an operator using `lift`, it is recommended that you create an\n * operator by simply returning `new Observable()` directly. See \"Creating new operators from\n * scratch\" section here: https://rxjs.dev/guide/operators\n */\n lift(operator?: Operator): Observable {\n const observable = new Observable();\n observable.source = this;\n observable.operator = operator;\n return observable;\n }\n\n subscribe(observerOrNext?: Partial> | ((value: T) => void)): Subscription;\n /** @deprecated Instead of passing separate callback arguments, use an observer argument. Signatures taking separate callback arguments will be removed in v8. Details: https://rxjs.dev/deprecations/subscribe-arguments */\n subscribe(next?: ((value: T) => void) | null, error?: ((error: any) => void) | null, complete?: (() => void) | null): Subscription;\n /**\n * Invokes an execution of an Observable and registers Observer handlers for notifications it will emit.\n *\n * Use it when you have all these Observables, but still nothing is happening.\n *\n * `subscribe` is not a regular operator, but a method that calls Observable's internal `subscribe` function. It\n * might be for example a function that you passed to Observable's constructor, but most of the time it is\n * a library implementation, which defines what will be emitted by an Observable, and when it be will emitted. This means\n * that calling `subscribe` is actually the moment when Observable starts its work, not when it is created, as it is often\n * the thought.\n *\n * Apart from starting the execution of an Observable, this method allows you to listen for values\n * that an Observable emits, as well as for when it completes or errors. You can achieve this in two\n * of the following ways.\n *\n * The first way is creating an object that implements {@link Observer} interface. It should have methods\n * defined by that interface, but note that it should be just a regular JavaScript object, which you can create\n * yourself in any way you want (ES6 class, classic function constructor, object literal etc.). In particular, do\n * not attempt to use any RxJS implementation details to create Observers - you don't need them. Remember also\n * that your object does not have to implement all methods. If you find yourself creating a method that doesn't\n * do anything, you can simply omit it. Note however, if the `error` method is not provided and an error happens,\n * it will be thrown asynchronously. Errors thrown asynchronously cannot be caught using `try`/`catch`. Instead,\n * use the {@link onUnhandledError} configuration option or use a runtime handler (like `window.onerror` or\n * `process.on('error)`) to be notified of unhandled errors. Because of this, it's recommended that you provide\n * an `error` method to avoid missing thrown errors.\n *\n * The second way is to give up on Observer object altogether and simply provide callback functions in place of its methods.\n * This means you can provide three functions as arguments to `subscribe`, where the first function is equivalent\n * of a `next` method, the second of an `error` method and the third of a `complete` method. Just as in case of an Observer,\n * if you do not need to listen for something, you can omit a function by passing `undefined` or `null`,\n * since `subscribe` recognizes these functions by where they were placed in function call. When it comes\n * to the `error` function, as with an Observer, if not provided, errors emitted by an Observable will be thrown asynchronously.\n *\n * You can, however, subscribe with no parameters at all. This may be the case where you're not interested in terminal events\n * and you also handled emissions internally by using operators (e.g. using `tap`).\n *\n * Whichever style of calling `subscribe` you use, in both cases it returns a Subscription object.\n * This object allows you to call `unsubscribe` on it, which in turn will stop the work that an Observable does and will clean\n * up all resources that an Observable used. Note that cancelling a subscription will not call `complete` callback\n * provided to `subscribe` function, which is reserved for a regular completion signal that comes from an Observable.\n *\n * Remember that callbacks provided to `subscribe` are not guaranteed to be called asynchronously.\n * It is an Observable itself that decides when these functions will be called. For example {@link of}\n * by default emits all its values synchronously. Always check documentation for how given Observable\n * will behave when subscribed and if its default behavior can be modified with a `scheduler`.\n *\n * #### Examples\n *\n * Subscribe with an {@link guide/observer Observer}\n *\n * ```ts\n * import { of } from 'rxjs';\n *\n * const sumObserver = {\n * sum: 0,\n * next(value) {\n * console.log('Adding: ' + value);\n * this.sum = this.sum + value;\n * },\n * error() {\n * // We actually could just remove this method,\n * // since we do not really care about errors right now.\n * },\n * complete() {\n * console.log('Sum equals: ' + this.sum);\n * }\n * };\n *\n * of(1, 2, 3) // Synchronously emits 1, 2, 3 and then completes.\n * .subscribe(sumObserver);\n *\n * // Logs:\n * // 'Adding: 1'\n * // 'Adding: 2'\n * // 'Adding: 3'\n * // 'Sum equals: 6'\n * ```\n *\n * Subscribe with functions ({@link deprecations/subscribe-arguments deprecated})\n *\n * ```ts\n * import { of } from 'rxjs'\n *\n * let sum = 0;\n *\n * of(1, 2, 3).subscribe(\n * value => {\n * console.log('Adding: ' + value);\n * sum = sum + value;\n * },\n * undefined,\n * () => console.log('Sum equals: ' + sum)\n * );\n *\n * // Logs:\n * // 'Adding: 1'\n * // 'Adding: 2'\n * // 'Adding: 3'\n * // 'Sum equals: 6'\n * ```\n *\n * Cancel a subscription\n *\n * ```ts\n * import { interval } from 'rxjs';\n *\n * const subscription = interval(1000).subscribe({\n * next(num) {\n * console.log(num)\n * },\n * complete() {\n * // Will not be called, even when cancelling subscription.\n * console.log('completed!');\n * }\n * });\n *\n * setTimeout(() => {\n * subscription.unsubscribe();\n * console.log('unsubscribed!');\n * }, 2500);\n *\n * // Logs:\n * // 0 after 1s\n * // 1 after 2s\n * // 'unsubscribed!' after 2.5s\n * ```\n *\n * @param {Observer|Function} observerOrNext (optional) Either an observer with methods to be called,\n * or the first of three possible handlers, which is the handler for each value emitted from the subscribed\n * Observable.\n * @param {Function} error (optional) A handler for a terminal event resulting from an error. If no error handler is provided,\n * the error will be thrown asynchronously as unhandled.\n * @param {Function} complete (optional) A handler for a terminal event resulting from successful completion.\n * @return {Subscription} a subscription reference to the registered handlers\n * @method subscribe\n */\n subscribe(\n observerOrNext?: Partial> | ((value: T) => void) | null,\n error?: ((error: any) => void) | null,\n complete?: (() => void) | null\n ): Subscription {\n const subscriber = isSubscriber(observerOrNext) ? observerOrNext : new SafeSubscriber(observerOrNext, error, complete);\n\n errorContext(() => {\n const { operator, source } = this;\n subscriber.add(\n operator\n ? // We're dealing with a subscription in the\n // operator chain to one of our lifted operators.\n operator.call(subscriber, source)\n : source\n ? // If `source` has a value, but `operator` does not, something that\n // had intimate knowledge of our API, like our `Subject`, must have\n // set it. We're going to just call `_subscribe` directly.\n this._subscribe(subscriber)\n : // In all other cases, we're likely wrapping a user-provided initializer\n // function, so we need to catch errors and handle them appropriately.\n this._trySubscribe(subscriber)\n );\n });\n\n return subscriber;\n }\n\n /** @internal */\n protected _trySubscribe(sink: Subscriber): TeardownLogic {\n try {\n return this._subscribe(sink);\n } catch (err) {\n // We don't need to return anything in this case,\n // because it's just going to try to `add()` to a subscription\n // above.\n sink.error(err);\n }\n }\n\n /**\n * Used as a NON-CANCELLABLE means of subscribing to an observable, for use with\n * APIs that expect promises, like `async/await`. You cannot unsubscribe from this.\n *\n * **WARNING**: Only use this with observables you *know* will complete. If the source\n * observable does not complete, you will end up with a promise that is hung up, and\n * potentially all of the state of an async function hanging out in memory. To avoid\n * this situation, look into adding something like {@link timeout}, {@link take},\n * {@link takeWhile}, or {@link takeUntil} amongst others.\n *\n * #### Example\n *\n * ```ts\n * import { interval, take } from 'rxjs';\n *\n * const source$ = interval(1000).pipe(take(4));\n *\n * async function getTotal() {\n * let total = 0;\n *\n * await source$.forEach(value => {\n * total += value;\n * console.log('observable -> ' + value);\n * });\n *\n * return total;\n * }\n *\n * getTotal().then(\n * total => console.log('Total: ' + total)\n * );\n *\n * // Expected:\n * // 'observable -> 0'\n * // 'observable -> 1'\n * // 'observable -> 2'\n * // 'observable -> 3'\n * // 'Total: 6'\n * ```\n *\n * @param next a handler for each value emitted by the observable\n * @return a promise that either resolves on observable completion or\n * rejects with the handled error\n */\n forEach(next: (value: T) => void): Promise;\n\n /**\n * @param next a handler for each value emitted by the observable\n * @param promiseCtor a constructor function used to instantiate the Promise\n * @return a promise that either resolves on observable completion or\n * rejects with the handled error\n * @deprecated Passing a Promise constructor will no longer be available\n * in upcoming versions of RxJS. This is because it adds weight to the library, for very\n * little benefit. If you need this functionality, it is recommended that you either\n * polyfill Promise, or you create an adapter to convert the returned native promise\n * to whatever promise implementation you wanted. Will be removed in v8.\n */\n forEach(next: (value: T) => void, promiseCtor: PromiseConstructorLike): Promise;\n\n forEach(next: (value: T) => void, promiseCtor?: PromiseConstructorLike): Promise {\n promiseCtor = getPromiseCtor(promiseCtor);\n\n return new promiseCtor((resolve, reject) => {\n const subscriber = new SafeSubscriber({\n next: (value) => {\n try {\n next(value);\n } catch (err) {\n reject(err);\n subscriber.unsubscribe();\n }\n },\n error: reject,\n complete: resolve,\n });\n this.subscribe(subscriber);\n }) as Promise;\n }\n\n /** @internal */\n protected _subscribe(subscriber: Subscriber): TeardownLogic {\n return this.source?.subscribe(subscriber);\n }\n\n /**\n * An interop point defined by the es7-observable spec https://github.com/zenparsing/es-observable\n * @method Symbol.observable\n * @return {Observable} this instance of the observable\n */\n [Symbol_observable]() {\n return this;\n }\n\n /* tslint:disable:max-line-length */\n pipe(): Observable;\n pipe(op1: OperatorFunction): Observable;\n pipe(op1: OperatorFunction, op2: OperatorFunction): Observable;\n pipe(op1: OperatorFunction, op2: OperatorFunction, op3: OperatorFunction): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction\n ): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction,\n op5: OperatorFunction\n ): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction,\n op5: OperatorFunction,\n op6: OperatorFunction\n ): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction,\n op5: OperatorFunction,\n op6: OperatorFunction,\n op7: OperatorFunction\n ): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction,\n op5: OperatorFunction,\n op6: OperatorFunction,\n op7: OperatorFunction,\n op8: OperatorFunction\n ): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction,\n op5: OperatorFunction,\n op6: OperatorFunction,\n op7: OperatorFunction,\n op8: OperatorFunction,\n op9: OperatorFunction\n ): Observable;\n pipe(\n op1: OperatorFunction,\n op2: OperatorFunction,\n op3: OperatorFunction,\n op4: OperatorFunction,\n op5: OperatorFunction,\n op6: OperatorFunction,\n op7: OperatorFunction,\n op8: OperatorFunction,\n op9: OperatorFunction,\n ...operations: OperatorFunction[]\n ): Observable;\n /* tslint:enable:max-line-length */\n\n /**\n * Used to stitch together functional operators into a chain.\n * @method pipe\n * @return {Observable} the Observable result of all of the operators having\n * been called in the order they were passed in.\n *\n * ## Example\n *\n * ```ts\n * import { interval, filter, map, scan } from 'rxjs';\n *\n * interval(1000)\n * .pipe(\n * filter(x => x % 2 === 0),\n * map(x => x + x),\n * scan((acc, x) => acc + x)\n * )\n * .subscribe(x => console.log(x));\n * ```\n */\n pipe(...operations: OperatorFunction[]): Observable {\n return pipeFromArray(operations)(this);\n }\n\n /* tslint:disable:max-line-length */\n /** @deprecated Replaced with {@link firstValueFrom} and {@link lastValueFrom}. Will be removed in v8. Details: https://rxjs.dev/deprecations/to-promise */\n toPromise(): Promise;\n /** @deprecated Replaced with {@link firstValueFrom} and {@link lastValueFrom}. Will be removed in v8. Details: https://rxjs.dev/deprecations/to-promise */\n toPromise(PromiseCtor: typeof Promise): Promise;\n /** @deprecated Replaced with {@link firstValueFrom} and {@link lastValueFrom}. Will be removed in v8. Details: https://rxjs.dev/deprecations/to-promise */\n toPromise(PromiseCtor: PromiseConstructorLike): Promise;\n /* tslint:enable:max-line-length */\n\n /**\n * Subscribe to this Observable and get a Promise resolving on\n * `complete` with the last emission (if any).\n *\n * **WARNING**: Only use this with observables you *know* will complete. If the source\n * observable does not complete, you will end up with a promise that is hung up, and\n * potentially all of the state of an async function hanging out in memory. To avoid\n * this situation, look into adding something like {@link timeout}, {@link take},\n * {@link takeWhile}, or {@link takeUntil} amongst others.\n *\n * @method toPromise\n * @param [promiseCtor] a constructor function used to instantiate\n * the Promise\n * @return A Promise that resolves with the last value emit, or\n * rejects on an error. If there were no emissions, Promise\n * resolves with undefined.\n * @deprecated Replaced with {@link firstValueFrom} and {@link lastValueFrom}. Will be removed in v8. Details: https://rxjs.dev/deprecations/to-promise\n */\n toPromise(promiseCtor?: PromiseConstructorLike): Promise {\n promiseCtor = getPromiseCtor(promiseCtor);\n\n return new promiseCtor((resolve, reject) => {\n let value: T | undefined;\n this.subscribe(\n (x: T) => (value = x),\n (err: any) => reject(err),\n () => resolve(value)\n );\n }) as Promise;\n }\n}\n\n/**\n * Decides between a passed promise constructor from consuming code,\n * A default configured promise constructor, and the native promise\n * constructor and returns it. If nothing can be found, it will throw\n * an error.\n * @param promiseCtor The optional promise constructor to passed by consuming code\n */\nfunction getPromiseCtor(promiseCtor: PromiseConstructorLike | undefined) {\n return promiseCtor ?? config.Promise ?? Promise;\n}\n\nfunction isObserver(value: any): value is Observer {\n return value && isFunction(value.next) && isFunction(value.error) && isFunction(value.complete);\n}\n\nfunction isSubscriber(value: any): value is Subscriber {\n return (value && value instanceof Subscriber) || (isObserver(value) && isSubscription(value));\n}\n", "import { Observable } from '../Observable';\nimport { Subscriber } from '../Subscriber';\nimport { OperatorFunction } from '../types';\nimport { isFunction } from './isFunction';\n\n/**\n * Used to determine if an object is an Observable with a lift function.\n */\nexport function hasLift(source: any): source is { lift: InstanceType['lift'] } {\n return isFunction(source?.lift);\n}\n\n/**\n * Creates an `OperatorFunction`. Used to define operators throughout the library in a concise way.\n * @param init The logic to connect the liftedSource to the subscriber at the moment of subscription.\n */\nexport function operate(\n init: (liftedSource: Observable, subscriber: Subscriber) => (() => void) | void\n): OperatorFunction {\n return (source: Observable) => {\n if (hasLift(source)) {\n return source.lift(function (this: Subscriber, liftedSource: Observable) {\n try {\n return init(liftedSource, this);\n } catch (err) {\n this.error(err);\n }\n });\n }\n throw new TypeError('Unable to lift unknown Observable type');\n };\n}\n", "import { Subscriber } from '../Subscriber';\n\n/**\n * Creates an instance of an `OperatorSubscriber`.\n * @param destination The downstream subscriber.\n * @param onNext Handles next values, only called if this subscriber is not stopped or closed. Any\n * error that occurs in this function is caught and sent to the `error` method of this subscriber.\n * @param onError Handles errors from the subscription, any errors that occur in this handler are caught\n * and send to the `destination` error handler.\n * @param onComplete Handles completion notification from the subscription. Any errors that occur in\n * this handler are sent to the `destination` error handler.\n * @param onFinalize Additional teardown logic here. This will only be called on teardown if the\n * subscriber itself is not already closed. This is called after all other teardown logic is executed.\n */\nexport function createOperatorSubscriber(\n destination: Subscriber,\n onNext?: (value: T) => void,\n onComplete?: () => void,\n onError?: (err: any) => void,\n onFinalize?: () => void\n): Subscriber {\n return new OperatorSubscriber(destination, onNext, onComplete, onError, onFinalize);\n}\n\n/**\n * A generic helper for allowing operators to be created with a Subscriber and\n * use closures to capture necessary state from the operator function itself.\n */\nexport class OperatorSubscriber extends Subscriber {\n /**\n * Creates an instance of an `OperatorSubscriber`.\n * @param destination The downstream subscriber.\n * @param onNext Handles next values, only called if this subscriber is not stopped or closed. Any\n * error that occurs in this function is caught and sent to the `error` method of this subscriber.\n * @param onError Handles errors from the subscription, any errors that occur in this handler are caught\n * and send to the `destination` error handler.\n * @param onComplete Handles completion notification from the subscription. Any errors that occur in\n * this handler are sent to the `destination` error handler.\n * @param onFinalize Additional finalization logic here. This will only be called on finalization if the\n * subscriber itself is not already closed. This is called after all other finalization logic is executed.\n * @param shouldUnsubscribe An optional check to see if an unsubscribe call should truly unsubscribe.\n * NOTE: This currently **ONLY** exists to support the strange behavior of {@link groupBy}, where unsubscription\n * to the resulting observable does not actually disconnect from the source if there are active subscriptions\n * to any grouped observable. (DO NOT EXPOSE OR USE EXTERNALLY!!!)\n */\n constructor(\n destination: Subscriber,\n onNext?: (value: T) => void,\n onComplete?: () => void,\n onError?: (err: any) => void,\n private onFinalize?: () => void,\n private shouldUnsubscribe?: () => boolean\n ) {\n // It's important - for performance reasons - that all of this class's\n // members are initialized and that they are always initialized in the same\n // order. This will ensure that all OperatorSubscriber instances have the\n // same hidden class in V8. This, in turn, will help keep the number of\n // hidden classes involved in property accesses within the base class as\n // low as possible. If the number of hidden classes involved exceeds four,\n // the property accesses will become megamorphic and performance penalties\n // will be incurred - i.e. inline caches won't be used.\n //\n // The reasons for ensuring all instances have the same hidden class are\n // further discussed in this blog post from Benedikt Meurer:\n // https://benediktmeurer.de/2018/03/23/impact-of-polymorphism-on-component-based-frameworks-like-react/\n super(destination);\n this._next = onNext\n ? function (this: OperatorSubscriber, value: T) {\n try {\n onNext(value);\n } catch (err) {\n destination.error(err);\n }\n }\n : super._next;\n this._error = onError\n ? function (this: OperatorSubscriber, err: any) {\n try {\n onError(err);\n } catch (err) {\n // Send any errors that occur down stream.\n destination.error(err);\n } finally {\n // Ensure finalization.\n this.unsubscribe();\n }\n }\n : super._error;\n this._complete = onComplete\n ? function (this: OperatorSubscriber) {\n try {\n onComplete();\n } catch (err) {\n // Send any errors that occur down stream.\n destination.error(err);\n } finally {\n // Ensure finalization.\n this.unsubscribe();\n }\n }\n : super._complete;\n }\n\n unsubscribe() {\n if (!this.shouldUnsubscribe || this.shouldUnsubscribe()) {\n const { closed } = this;\n super.unsubscribe();\n // Execute additional teardown if we have any and we didn't already do so.\n !closed && this.onFinalize?.();\n }\n }\n}\n", "import { Subscription } from '../Subscription';\n\ninterface AnimationFrameProvider {\n schedule(callback: FrameRequestCallback): Subscription;\n requestAnimationFrame: typeof requestAnimationFrame;\n cancelAnimationFrame: typeof cancelAnimationFrame;\n delegate:\n | {\n requestAnimationFrame: typeof requestAnimationFrame;\n cancelAnimationFrame: typeof cancelAnimationFrame;\n }\n | undefined;\n}\n\nexport const animationFrameProvider: AnimationFrameProvider = {\n // When accessing the delegate, use the variable rather than `this` so that\n // the functions can be called without being bound to the provider.\n schedule(callback) {\n let request = requestAnimationFrame;\n let cancel: typeof cancelAnimationFrame | undefined = cancelAnimationFrame;\n const { delegate } = animationFrameProvider;\n if (delegate) {\n request = delegate.requestAnimationFrame;\n cancel = delegate.cancelAnimationFrame;\n }\n const handle = request((timestamp) => {\n // Clear the cancel function. The request has been fulfilled, so\n // attempting to cancel the request upon unsubscription would be\n // pointless.\n cancel = undefined;\n callback(timestamp);\n });\n return new Subscription(() => cancel?.(handle));\n },\n requestAnimationFrame(...args) {\n const { delegate } = animationFrameProvider;\n return (delegate?.requestAnimationFrame || requestAnimationFrame)(...args);\n },\n cancelAnimationFrame(...args) {\n const { delegate } = animationFrameProvider;\n return (delegate?.cancelAnimationFrame || cancelAnimationFrame)(...args);\n },\n delegate: undefined,\n};\n", "import { createErrorClass } from './createErrorClass';\n\nexport interface ObjectUnsubscribedError extends Error {}\n\nexport interface ObjectUnsubscribedErrorCtor {\n /**\n * @deprecated Internal implementation detail. Do not construct error instances.\n * Cannot be tagged as internal: https://github.com/ReactiveX/rxjs/issues/6269\n */\n new (): ObjectUnsubscribedError;\n}\n\n/**\n * An error thrown when an action is invalid because the object has been\n * unsubscribed.\n *\n * @see {@link Subject}\n * @see {@link BehaviorSubject}\n *\n * @class ObjectUnsubscribedError\n */\nexport const ObjectUnsubscribedError: ObjectUnsubscribedErrorCtor = createErrorClass(\n (_super) =>\n function ObjectUnsubscribedErrorImpl(this: any) {\n _super(this);\n this.name = 'ObjectUnsubscribedError';\n this.message = 'object unsubscribed';\n }\n);\n", "import { Operator } from './Operator';\nimport { Observable } from './Observable';\nimport { Subscriber } from './Subscriber';\nimport { Subscription, EMPTY_SUBSCRIPTION } from './Subscription';\nimport { Observer, SubscriptionLike, TeardownLogic } from './types';\nimport { ObjectUnsubscribedError } from './util/ObjectUnsubscribedError';\nimport { arrRemove } from './util/arrRemove';\nimport { errorContext } from './util/errorContext';\n\n/**\n * A Subject is a special type of Observable that allows values to be\n * multicasted to many Observers. Subjects are like EventEmitters.\n *\n * Every Subject is an Observable and an Observer. You can subscribe to a\n * Subject, and you can call next to feed values as well as error and complete.\n */\nexport class Subject extends Observable implements SubscriptionLike {\n closed = false;\n\n private currentObservers: Observer[] | null = null;\n\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n observers: Observer[] = [];\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n isStopped = false;\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n hasError = false;\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n thrownError: any = null;\n\n /**\n * Creates a \"subject\" by basically gluing an observer to an observable.\n *\n * @nocollapse\n * @deprecated Recommended you do not use. Will be removed at some point in the future. Plans for replacement still under discussion.\n */\n static create: (...args: any[]) => any = (destination: Observer, source: Observable): AnonymousSubject => {\n return new AnonymousSubject(destination, source);\n };\n\n constructor() {\n // NOTE: This must be here to obscure Observable's constructor.\n super();\n }\n\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n lift(operator: Operator): Observable {\n const subject = new AnonymousSubject(this, this);\n subject.operator = operator as any;\n return subject as any;\n }\n\n /** @internal */\n protected _throwIfClosed() {\n if (this.closed) {\n throw new ObjectUnsubscribedError();\n }\n }\n\n next(value: T) {\n errorContext(() => {\n this._throwIfClosed();\n if (!this.isStopped) {\n if (!this.currentObservers) {\n this.currentObservers = Array.from(this.observers);\n }\n for (const observer of this.currentObservers) {\n observer.next(value);\n }\n }\n });\n }\n\n error(err: any) {\n errorContext(() => {\n this._throwIfClosed();\n if (!this.isStopped) {\n this.hasError = this.isStopped = true;\n this.thrownError = err;\n const { observers } = this;\n while (observers.length) {\n observers.shift()!.error(err);\n }\n }\n });\n }\n\n complete() {\n errorContext(() => {\n this._throwIfClosed();\n if (!this.isStopped) {\n this.isStopped = true;\n const { observers } = this;\n while (observers.length) {\n observers.shift()!.complete();\n }\n }\n });\n }\n\n unsubscribe() {\n this.isStopped = this.closed = true;\n this.observers = this.currentObservers = null!;\n }\n\n get observed() {\n return this.observers?.length > 0;\n }\n\n /** @internal */\n protected _trySubscribe(subscriber: Subscriber): TeardownLogic {\n this._throwIfClosed();\n return super._trySubscribe(subscriber);\n }\n\n /** @internal */\n protected _subscribe(subscriber: Subscriber): Subscription {\n this._throwIfClosed();\n this._checkFinalizedStatuses(subscriber);\n return this._innerSubscribe(subscriber);\n }\n\n /** @internal */\n protected _innerSubscribe(subscriber: Subscriber) {\n const { hasError, isStopped, observers } = this;\n if (hasError || isStopped) {\n return EMPTY_SUBSCRIPTION;\n }\n this.currentObservers = null;\n observers.push(subscriber);\n return new Subscription(() => {\n this.currentObservers = null;\n arrRemove(observers, subscriber);\n });\n }\n\n /** @internal */\n protected _checkFinalizedStatuses(subscriber: Subscriber) {\n const { hasError, thrownError, isStopped } = this;\n if (hasError) {\n subscriber.error(thrownError);\n } else if (isStopped) {\n subscriber.complete();\n }\n }\n\n /**\n * Creates a new Observable with this Subject as the source. You can do this\n * to create custom Observer-side logic of the Subject and conceal it from\n * code that uses the Observable.\n * @return {Observable} Observable that the Subject casts to\n */\n asObservable(): Observable {\n const observable: any = new Observable();\n observable.source = this;\n return observable;\n }\n}\n\n/**\n * @class AnonymousSubject\n */\nexport class AnonymousSubject extends Subject {\n constructor(\n /** @deprecated Internal implementation detail, do not use directly. Will be made internal in v8. */\n public destination?: Observer,\n source?: Observable\n ) {\n super();\n this.source = source;\n }\n\n next(value: T) {\n this.destination?.next?.(value);\n }\n\n error(err: any) {\n this.destination?.error?.(err);\n }\n\n complete() {\n this.destination?.complete?.();\n }\n\n /** @internal */\n protected _subscribe(subscriber: Subscriber): Subscription {\n return this.source?.subscribe(subscriber) ?? EMPTY_SUBSCRIPTION;\n }\n}\n", "import { Subject } from './Subject';\nimport { Subscriber } from './Subscriber';\nimport { Subscription } from './Subscription';\n\n/**\n * A variant of Subject that requires an initial value and emits its current\n * value whenever it is subscribed to.\n *\n * @class BehaviorSubject\n */\nexport class BehaviorSubject extends Subject {\n constructor(private _value: T) {\n super();\n }\n\n get value(): T {\n return this.getValue();\n }\n\n /** @internal */\n protected _subscribe(subscriber: Subscriber): Subscription {\n const subscription = super._subscribe(subscriber);\n !subscription.closed && subscriber.next(this._value);\n return subscription;\n }\n\n getValue(): T {\n const { hasError, thrownError, _value } = this;\n if (hasError) {\n throw thrownError;\n }\n this._throwIfClosed();\n return _value;\n }\n\n next(value: T): void {\n super.next((this._value = value));\n }\n}\n", "import { TimestampProvider } from '../types';\n\ninterface DateTimestampProvider extends TimestampProvider {\n delegate: TimestampProvider | undefined;\n}\n\nexport const dateTimestampProvider: DateTimestampProvider = {\n now() {\n // Use the variable rather than `this` so that the function can be called\n // without being bound to the provider.\n return (dateTimestampProvider.delegate || Date).now();\n },\n delegate: undefined,\n};\n", "import { Subject } from './Subject';\nimport { TimestampProvider } from './types';\nimport { Subscriber } from './Subscriber';\nimport { Subscription } from './Subscription';\nimport { dateTimestampProvider } from './scheduler/dateTimestampProvider';\n\n/**\n * A variant of {@link Subject} that \"replays\" old values to new subscribers by emitting them when they first subscribe.\n *\n * `ReplaySubject` has an internal buffer that will store a specified number of values that it has observed. Like `Subject`,\n * `ReplaySubject` \"observes\" values by having them passed to its `next` method. When it observes a value, it will store that\n * value for a time determined by the configuration of the `ReplaySubject`, as passed to its constructor.\n *\n * When a new subscriber subscribes to the `ReplaySubject` instance, it will synchronously emit all values in its buffer in\n * a First-In-First-Out (FIFO) manner. The `ReplaySubject` will also complete, if it has observed completion; and it will\n * error if it has observed an error.\n *\n * There are two main configuration items to be concerned with:\n *\n * 1. `bufferSize` - This will determine how many items are stored in the buffer, defaults to infinite.\n * 2. `windowTime` - The amount of time to hold a value in the buffer before removing it from the buffer.\n *\n * Both configurations may exist simultaneously. So if you would like to buffer a maximum of 3 values, as long as the values\n * are less than 2 seconds old, you could do so with a `new ReplaySubject(3, 2000)`.\n *\n * ### Differences with BehaviorSubject\n *\n * `BehaviorSubject` is similar to `new ReplaySubject(1)`, with a couple of exceptions:\n *\n * 1. `BehaviorSubject` comes \"primed\" with a single value upon construction.\n * 2. `ReplaySubject` will replay values, even after observing an error, where `BehaviorSubject` will not.\n *\n * @see {@link Subject}\n * @see {@link BehaviorSubject}\n * @see {@link shareReplay}\n */\nexport class ReplaySubject extends Subject {\n private _buffer: (T | number)[] = [];\n private _infiniteTimeWindow = true;\n\n /**\n * @param bufferSize The size of the buffer to replay on subscription\n * @param windowTime The amount of time the buffered items will stay buffered\n * @param timestampProvider An object with a `now()` method that provides the current timestamp. This is used to\n * calculate the amount of time something has been buffered.\n */\n constructor(\n private _bufferSize = Infinity,\n private _windowTime = Infinity,\n private _timestampProvider: TimestampProvider = dateTimestampProvider\n ) {\n super();\n this._infiniteTimeWindow = _windowTime === Infinity;\n this._bufferSize = Math.max(1, _bufferSize);\n this._windowTime = Math.max(1, _windowTime);\n }\n\n next(value: T): void {\n const { isStopped, _buffer, _infiniteTimeWindow, _timestampProvider, _windowTime } = this;\n if (!isStopped) {\n _buffer.push(value);\n !_infiniteTimeWindow && _buffer.push(_timestampProvider.now() + _windowTime);\n }\n this._trimBuffer();\n super.next(value);\n }\n\n /** @internal */\n protected _subscribe(subscriber: Subscriber): Subscription {\n this._throwIfClosed();\n this._trimBuffer();\n\n const subscription = this._innerSubscribe(subscriber);\n\n const { _infiniteTimeWindow, _buffer } = this;\n // We use a copy here, so reentrant code does not mutate our array while we're\n // emitting it to a new subscriber.\n const copy = _buffer.slice();\n for (let i = 0; i < copy.length && !subscriber.closed; i += _infiniteTimeWindow ? 1 : 2) {\n subscriber.next(copy[i] as T);\n }\n\n this._checkFinalizedStatuses(subscriber);\n\n return subscription;\n }\n\n private _trimBuffer() {\n const { _bufferSize, _timestampProvider, _buffer, _infiniteTimeWindow } = this;\n // If we don't have an infinite buffer size, and we're over the length,\n // use splice to truncate the old buffer values off. Note that we have to\n // double the size for instances where we're not using an infinite time window\n // because we're storing the values and the timestamps in the same array.\n const adjustedBufferSize = (_infiniteTimeWindow ? 1 : 2) * _bufferSize;\n _bufferSize < Infinity && adjustedBufferSize < _buffer.length && _buffer.splice(0, _buffer.length - adjustedBufferSize);\n\n // Now, if we're not in an infinite time window, remove all values where the time is\n // older than what is allowed.\n if (!_infiniteTimeWindow) {\n const now = _timestampProvider.now();\n let last = 0;\n // Search the array for the first timestamp that isn't expired and\n // truncate the buffer up to that point.\n for (let i = 1; i < _buffer.length && (_buffer[i] as number) <= now; i += 2) {\n last = i;\n }\n last && _buffer.splice(0, last + 1);\n }\n }\n}\n", "import { Scheduler } from '../Scheduler';\nimport { Subscription } from '../Subscription';\nimport { SchedulerAction } from '../types';\n\n/**\n * A unit of work to be executed in a `scheduler`. An action is typically\n * created from within a {@link SchedulerLike} and an RxJS user does not need to concern\n * themselves about creating and manipulating an Action.\n *\n * ```ts\n * class Action extends Subscription {\n * new (scheduler: Scheduler, work: (state?: T) => void);\n * schedule(state?: T, delay: number = 0): Subscription;\n * }\n * ```\n *\n * @class Action\n */\nexport class Action extends Subscription {\n constructor(scheduler: Scheduler, work: (this: SchedulerAction, state?: T) => void) {\n super();\n }\n /**\n * Schedules this action on its parent {@link SchedulerLike} for execution. May be passed\n * some context object, `state`. May happen at some point in the future,\n * according to the `delay` parameter, if specified.\n * @param {T} [state] Some contextual data that the `work` function uses when\n * called by the Scheduler.\n * @param {number} [delay] Time to wait before executing the work, where the\n * time unit is implicit and defined by the Scheduler.\n * @return {void}\n */\n public schedule(state?: T, delay: number = 0): Subscription {\n return this;\n }\n}\n", "import type { TimerHandle } from './timerHandle';\ntype SetIntervalFunction = (handler: () => void, timeout?: number, ...args: any[]) => TimerHandle;\ntype ClearIntervalFunction = (handle: TimerHandle) => void;\n\ninterface IntervalProvider {\n setInterval: SetIntervalFunction;\n clearInterval: ClearIntervalFunction;\n delegate:\n | {\n setInterval: SetIntervalFunction;\n clearInterval: ClearIntervalFunction;\n }\n | undefined;\n}\n\nexport const intervalProvider: IntervalProvider = {\n // When accessing the delegate, use the variable rather than `this` so that\n // the functions can be called without being bound to the provider.\n setInterval(handler: () => void, timeout?: number, ...args) {\n const { delegate } = intervalProvider;\n if (delegate?.setInterval) {\n return delegate.setInterval(handler, timeout, ...args);\n }\n return setInterval(handler, timeout, ...args);\n },\n clearInterval(handle) {\n const { delegate } = intervalProvider;\n return (delegate?.clearInterval || clearInterval)(handle as any);\n },\n delegate: undefined,\n};\n", "import { Action } from './Action';\nimport { SchedulerAction } from '../types';\nimport { Subscription } from '../Subscription';\nimport { AsyncScheduler } from './AsyncScheduler';\nimport { intervalProvider } from './intervalProvider';\nimport { arrRemove } from '../util/arrRemove';\nimport { TimerHandle } from './timerHandle';\n\nexport class AsyncAction extends Action {\n public id: TimerHandle | undefined;\n public state?: T;\n // @ts-ignore: Property has no initializer and is not definitely assigned\n public delay: number;\n protected pending: boolean = false;\n\n constructor(protected scheduler: AsyncScheduler, protected work: (this: SchedulerAction, state?: T) => void) {\n super(scheduler, work);\n }\n\n public schedule(state?: T, delay: number = 0): Subscription {\n if (this.closed) {\n return this;\n }\n\n // Always replace the current state with the new state.\n this.state = state;\n\n const id = this.id;\n const scheduler = this.scheduler;\n\n //\n // Important implementation note:\n //\n // Actions only execute once by default, unless rescheduled from within the\n // scheduled callback. This allows us to implement single and repeat\n // actions via the same code path, without adding API surface area, as well\n // as mimic traditional recursion but across asynchronous boundaries.\n //\n // However, JS runtimes and timers distinguish between intervals achieved by\n // serial `setTimeout` calls vs. a single `setInterval` call. An interval of\n // serial `setTimeout` calls can be individually delayed, which delays\n // scheduling the next `setTimeout`, and so on. `setInterval` attempts to\n // guarantee the interval callback will be invoked more precisely to the\n // interval period, regardless of load.\n //\n // Therefore, we use `setInterval` to schedule single and repeat actions.\n // If the action reschedules itself with the same delay, the interval is not\n // canceled. If the action doesn't reschedule, or reschedules with a\n // different delay, the interval will be canceled after scheduled callback\n // execution.\n //\n if (id != null) {\n this.id = this.recycleAsyncId(scheduler, id, delay);\n }\n\n // Set the pending flag indicating that this action has been scheduled, or\n // has recursively rescheduled itself.\n this.pending = true;\n\n this.delay = delay;\n // If this action has already an async Id, don't request a new one.\n this.id = this.id ?? this.requestAsyncId(scheduler, this.id, delay);\n\n return this;\n }\n\n protected requestAsyncId(scheduler: AsyncScheduler, _id?: TimerHandle, delay: number = 0): TimerHandle {\n return intervalProvider.setInterval(scheduler.flush.bind(scheduler, this), delay);\n }\n\n protected recycleAsyncId(_scheduler: AsyncScheduler, id?: TimerHandle, delay: number | null = 0): TimerHandle | undefined {\n // If this action is rescheduled with the same delay time, don't clear the interval id.\n if (delay != null && this.delay === delay && this.pending === false) {\n return id;\n }\n // Otherwise, if the action's delay time is different from the current delay,\n // or the action has been rescheduled before it's executed, clear the interval id\n if (id != null) {\n intervalProvider.clearInterval(id);\n }\n\n return undefined;\n }\n\n /**\n * Immediately executes this action and the `work` it contains.\n * @return {any}\n */\n public execute(state: T, delay: number): any {\n if (this.closed) {\n return new Error('executing a cancelled action');\n }\n\n this.pending = false;\n const error = this._execute(state, delay);\n if (error) {\n return error;\n } else if (this.pending === false && this.id != null) {\n // Dequeue if the action didn't reschedule itself. Don't call\n // unsubscribe(), because the action could reschedule later.\n // For example:\n // ```\n // scheduler.schedule(function doWork(counter) {\n // /* ... I'm a busy worker bee ... */\n // var originalAction = this;\n // /* wait 100ms before rescheduling the action */\n // setTimeout(function () {\n // originalAction.schedule(counter + 1);\n // }, 100);\n // }, 1000);\n // ```\n this.id = this.recycleAsyncId(this.scheduler, this.id, null);\n }\n }\n\n protected _execute(state: T, _delay: number): any {\n let errored: boolean = false;\n let errorValue: any;\n try {\n this.work(state);\n } catch (e) {\n errored = true;\n // HACK: Since code elsewhere is relying on the \"truthiness\" of the\n // return here, we can't have it return \"\" or 0 or false.\n // TODO: Clean this up when we refactor schedulers mid-version-8 or so.\n errorValue = e ? e : new Error('Scheduled action threw falsy error');\n }\n if (errored) {\n this.unsubscribe();\n return errorValue;\n }\n }\n\n unsubscribe() {\n if (!this.closed) {\n const { id, scheduler } = this;\n const { actions } = scheduler;\n\n this.work = this.state = this.scheduler = null!;\n this.pending = false;\n\n arrRemove(actions, this);\n if (id != null) {\n this.id = this.recycleAsyncId(scheduler, id, null);\n }\n\n this.delay = null!;\n super.unsubscribe();\n }\n }\n}\n", "import { Action } from './scheduler/Action';\nimport { Subscription } from './Subscription';\nimport { SchedulerLike, SchedulerAction } from './types';\nimport { dateTimestampProvider } from './scheduler/dateTimestampProvider';\n\n/**\n * An execution context and a data structure to order tasks and schedule their\n * execution. Provides a notion of (potentially virtual) time, through the\n * `now()` getter method.\n *\n * Each unit of work in a Scheduler is called an `Action`.\n *\n * ```ts\n * class Scheduler {\n * now(): number;\n * schedule(work, delay?, state?): Subscription;\n * }\n * ```\n *\n * @class Scheduler\n * @deprecated Scheduler is an internal implementation detail of RxJS, and\n * should not be used directly. Rather, create your own class and implement\n * {@link SchedulerLike}. Will be made internal in v8.\n */\nexport class Scheduler implements SchedulerLike {\n public static now: () => number = dateTimestampProvider.now;\n\n constructor(private schedulerActionCtor: typeof Action, now: () => number = Scheduler.now) {\n this.now = now;\n }\n\n /**\n * A getter method that returns a number representing the current time\n * (at the time this function was called) according to the scheduler's own\n * internal clock.\n * @return {number} A number that represents the current time. May or may not\n * have a relation to wall-clock time. May or may not refer to a time unit\n * (e.g. milliseconds).\n */\n public now: () => number;\n\n /**\n * Schedules a function, `work`, for execution. May happen at some point in\n * the future, according to the `delay` parameter, if specified. May be passed\n * some context object, `state`, which will be passed to the `work` function.\n *\n * The given arguments will be processed an stored as an Action object in a\n * queue of actions.\n *\n * @param {function(state: ?T): ?Subscription} work A function representing a\n * task, or some unit of work to be executed by the Scheduler.\n * @param {number} [delay] Time to wait before executing the work, where the\n * time unit is implicit and defined by the Scheduler itself.\n * @param {T} [state] Some contextual data that the `work` function uses when\n * called by the Scheduler.\n * @return {Subscription} A subscription in order to be able to unsubscribe\n * the scheduled work.\n */\n public schedule(work: (this: SchedulerAction, state?: T) => void, delay: number = 0, state?: T): Subscription {\n return new this.schedulerActionCtor(this, work).schedule(state, delay);\n }\n}\n", "import { Scheduler } from '../Scheduler';\nimport { Action } from './Action';\nimport { AsyncAction } from './AsyncAction';\nimport { TimerHandle } from './timerHandle';\n\nexport class AsyncScheduler extends Scheduler {\n public actions: Array> = [];\n /**\n * A flag to indicate whether the Scheduler is currently executing a batch of\n * queued actions.\n * @type {boolean}\n * @internal\n */\n public _active: boolean = false;\n /**\n * An internal ID used to track the latest asynchronous task such as those\n * coming from `setTimeout`, `setInterval`, `requestAnimationFrame`, and\n * others.\n * @type {any}\n * @internal\n */\n public _scheduled: TimerHandle | undefined;\n\n constructor(SchedulerAction: typeof Action, now: () => number = Scheduler.now) {\n super(SchedulerAction, now);\n }\n\n public flush(action: AsyncAction): void {\n const { actions } = this;\n\n if (this._active) {\n actions.push(action);\n return;\n }\n\n let error: any;\n this._active = true;\n\n do {\n if ((error = action.execute(action.state, action.delay))) {\n break;\n }\n } while ((action = actions.shift()!)); // exhaust the scheduler queue\n\n this._active = false;\n\n if (error) {\n while ((action = actions.shift()!)) {\n action.unsubscribe();\n }\n throw error;\n }\n }\n}\n", "import { AsyncAction } from './AsyncAction';\nimport { AsyncScheduler } from './AsyncScheduler';\n\n/**\n *\n * Async Scheduler\n *\n * Schedule task as if you used setTimeout(task, duration)\n *\n * `async` scheduler schedules tasks asynchronously, by putting them on the JavaScript\n * event loop queue. It is best used to delay tasks in time or to schedule tasks repeating\n * in intervals.\n *\n * If you just want to \"defer\" task, that is to perform it right after currently\n * executing synchronous code ends (commonly achieved by `setTimeout(deferredTask, 0)`),\n * better choice will be the {@link asapScheduler} scheduler.\n *\n * ## Examples\n * Use async scheduler to delay task\n * ```ts\n * import { asyncScheduler } from 'rxjs';\n *\n * const task = () => console.log('it works!');\n *\n * asyncScheduler.schedule(task, 2000);\n *\n * // After 2 seconds logs:\n * // \"it works!\"\n * ```\n *\n * Use async scheduler to repeat task in intervals\n * ```ts\n * import { asyncScheduler } from 'rxjs';\n *\n * function task(state) {\n * console.log(state);\n * this.schedule(state + 1, 1000); // `this` references currently executing Action,\n * // which we reschedule with new state and delay\n * }\n *\n * asyncScheduler.schedule(task, 3000, 0);\n *\n * // Logs:\n * // 0 after 3s\n * // 1 after 4s\n * // 2 after 5s\n * // 3 after 6s\n * ```\n */\n\nexport const asyncScheduler = new AsyncScheduler(AsyncAction);\n\n/**\n * @deprecated Renamed to {@link asyncScheduler}. Will be removed in v8.\n */\nexport const async = asyncScheduler;\n", "import { AsyncAction } from './AsyncAction';\nimport { Subscription } from '../Subscription';\nimport { QueueScheduler } from './QueueScheduler';\nimport { SchedulerAction } from '../types';\nimport { TimerHandle } from './timerHandle';\n\nexport class QueueAction extends AsyncAction {\n constructor(protected scheduler: QueueScheduler, protected work: (this: SchedulerAction, state?: T) => void) {\n super(scheduler, work);\n }\n\n public schedule(state?: T, delay: number = 0): Subscription {\n if (delay > 0) {\n return super.schedule(state, delay);\n }\n this.delay = delay;\n this.state = state;\n this.scheduler.flush(this);\n return this;\n }\n\n public execute(state: T, delay: number): any {\n return delay > 0 || this.closed ? super.execute(state, delay) : this._execute(state, delay);\n }\n\n protected requestAsyncId(scheduler: QueueScheduler, id?: TimerHandle, delay: number = 0): TimerHandle {\n // If delay exists and is greater than 0, or if the delay is null (the\n // action wasn't rescheduled) but was originally scheduled as an async\n // action, then recycle as an async action.\n\n if ((delay != null && delay > 0) || (delay == null && this.delay > 0)) {\n return super.requestAsyncId(scheduler, id, delay);\n }\n\n // Otherwise flush the scheduler starting with this action.\n scheduler.flush(this);\n\n // HACK: In the past, this was returning `void`. However, `void` isn't a valid\n // `TimerHandle`, and generally the return value here isn't really used. So the\n // compromise is to return `0` which is both \"falsy\" and a valid `TimerHandle`,\n // as opposed to refactoring every other instanceo of `requestAsyncId`.\n return 0;\n }\n}\n", "import { AsyncScheduler } from './AsyncScheduler';\n\nexport class QueueScheduler extends AsyncScheduler {\n}\n", "import { QueueAction } from './QueueAction';\nimport { QueueScheduler } from './QueueScheduler';\n\n/**\n *\n * Queue Scheduler\n *\n * Put every next task on a queue, instead of executing it immediately\n *\n * `queue` scheduler, when used with delay, behaves the same as {@link asyncScheduler} scheduler.\n *\n * When used without delay, it schedules given task synchronously - executes it right when\n * it is scheduled. However when called recursively, that is when inside the scheduled task,\n * another task is scheduled with queue scheduler, instead of executing immediately as well,\n * that task will be put on a queue and wait for current one to finish.\n *\n * This means that when you execute task with `queue` scheduler, you are sure it will end\n * before any other task scheduled with that scheduler will start.\n *\n * ## Examples\n * Schedule recursively first, then do something\n * ```ts\n * import { queueScheduler } from 'rxjs';\n *\n * queueScheduler.schedule(() => {\n * queueScheduler.schedule(() => console.log('second')); // will not happen now, but will be put on a queue\n *\n * console.log('first');\n * });\n *\n * // Logs:\n * // \"first\"\n * // \"second\"\n * ```\n *\n * Reschedule itself recursively\n * ```ts\n * import { queueScheduler } from 'rxjs';\n *\n * queueScheduler.schedule(function(state) {\n * if (state !== 0) {\n * console.log('before', state);\n * this.schedule(state - 1); // `this` references currently executing Action,\n * // which we reschedule with new state\n * console.log('after', state);\n * }\n * }, 0, 3);\n *\n * // In scheduler that runs recursively, you would expect:\n * // \"before\", 3\n * // \"before\", 2\n * // \"before\", 1\n * // \"after\", 1\n * // \"after\", 2\n * // \"after\", 3\n *\n * // But with queue it logs:\n * // \"before\", 3\n * // \"after\", 3\n * // \"before\", 2\n * // \"after\", 2\n * // \"before\", 1\n * // \"after\", 1\n * ```\n */\n\nexport const queueScheduler = new QueueScheduler(QueueAction);\n\n/**\n * @deprecated Renamed to {@link queueScheduler}. Will be removed in v8.\n */\nexport const queue = queueScheduler;\n", "import { AsyncAction } from './AsyncAction';\nimport { AnimationFrameScheduler } from './AnimationFrameScheduler';\nimport { SchedulerAction } from '../types';\nimport { animationFrameProvider } from './animationFrameProvider';\nimport { TimerHandle } from './timerHandle';\n\nexport class AnimationFrameAction extends AsyncAction {\n constructor(protected scheduler: AnimationFrameScheduler, protected work: (this: SchedulerAction, state?: T) => void) {\n super(scheduler, work);\n }\n\n protected requestAsyncId(scheduler: AnimationFrameScheduler, id?: TimerHandle, delay: number = 0): TimerHandle {\n // If delay is greater than 0, request as an async action.\n if (delay !== null && delay > 0) {\n return super.requestAsyncId(scheduler, id, delay);\n }\n // Push the action to the end of the scheduler queue.\n scheduler.actions.push(this);\n // If an animation frame has already been requested, don't request another\n // one. If an animation frame hasn't been requested yet, request one. Return\n // the current animation frame request id.\n return scheduler._scheduled || (scheduler._scheduled = animationFrameProvider.requestAnimationFrame(() => scheduler.flush(undefined)));\n }\n\n protected recycleAsyncId(scheduler: AnimationFrameScheduler, id?: TimerHandle, delay: number = 0): TimerHandle | undefined {\n // If delay exists and is greater than 0, or if the delay is null (the\n // action wasn't rescheduled) but was originally scheduled as an async\n // action, then recycle as an async action.\n if (delay != null ? delay > 0 : this.delay > 0) {\n return super.recycleAsyncId(scheduler, id, delay);\n }\n // If the scheduler queue has no remaining actions with the same async id,\n // cancel the requested animation frame and set the scheduled flag to\n // undefined so the next AnimationFrameAction will request its own.\n const { actions } = scheduler;\n if (id != null && actions[actions.length - 1]?.id !== id) {\n animationFrameProvider.cancelAnimationFrame(id as number);\n scheduler._scheduled = undefined;\n }\n // Return undefined so the action knows to request a new async id if it's rescheduled.\n return undefined;\n }\n}\n", "import { AsyncAction } from './AsyncAction';\nimport { AsyncScheduler } from './AsyncScheduler';\n\nexport class AnimationFrameScheduler extends AsyncScheduler {\n public flush(action?: AsyncAction): void {\n this._active = true;\n // The async id that effects a call to flush is stored in _scheduled.\n // Before executing an action, it's necessary to check the action's async\n // id to determine whether it's supposed to be executed in the current\n // flush.\n // Previous implementations of this method used a count to determine this,\n // but that was unsound, as actions that are unsubscribed - i.e. cancelled -\n // are removed from the actions array and that can shift actions that are\n // scheduled to be executed in a subsequent flush into positions at which\n // they are executed within the current flush.\n const flushId = this._scheduled;\n this._scheduled = undefined;\n\n const { actions } = this;\n let error: any;\n action = action || actions.shift()!;\n\n do {\n if ((error = action.execute(action.state, action.delay))) {\n break;\n }\n } while ((action = actions[0]) && action.id === flushId && actions.shift());\n\n this._active = false;\n\n if (error) {\n while ((action = actions[0]) && action.id === flushId && actions.shift()) {\n action.unsubscribe();\n }\n throw error;\n }\n }\n}\n", "import { AnimationFrameAction } from './AnimationFrameAction';\nimport { AnimationFrameScheduler } from './AnimationFrameScheduler';\n\n/**\n *\n * Animation Frame Scheduler\n *\n * Perform task when `window.requestAnimationFrame` would fire\n *\n * When `animationFrame` scheduler is used with delay, it will fall back to {@link asyncScheduler} scheduler\n * behaviour.\n *\n * Without delay, `animationFrame` scheduler can be used to create smooth browser animations.\n * It makes sure scheduled task will happen just before next browser content repaint,\n * thus performing animations as efficiently as possible.\n *\n * ## Example\n * Schedule div height animation\n * ```ts\n * // html:
\n * import { animationFrameScheduler } from 'rxjs';\n *\n * const div = document.querySelector('div');\n *\n * animationFrameScheduler.schedule(function(height) {\n * div.style.height = height + \"px\";\n *\n * this.schedule(height + 1); // `this` references currently executing Action,\n * // which we reschedule with new state\n * }, 0, 0);\n *\n * // You will see a div element growing in height\n * ```\n */\n\nexport const animationFrameScheduler = new AnimationFrameScheduler(AnimationFrameAction);\n\n/**\n * @deprecated Renamed to {@link animationFrameScheduler}. Will be removed in v8.\n */\nexport const animationFrame = animationFrameScheduler;\n", "import { Observable } from '../Observable';\nimport { SchedulerLike } from '../types';\n\n/**\n * A simple Observable that emits no items to the Observer and immediately\n * emits a complete notification.\n *\n * Just emits 'complete', and nothing else.\n *\n * ![](empty.png)\n *\n * A simple Observable that only emits the complete notification. It can be used\n * for composing with other Observables, such as in a {@link mergeMap}.\n *\n * ## Examples\n *\n * Log complete notification\n *\n * ```ts\n * import { EMPTY } from 'rxjs';\n *\n * EMPTY.subscribe({\n * next: () => console.log('Next'),\n * complete: () => console.log('Complete!')\n * });\n *\n * // Outputs\n * // Complete!\n * ```\n *\n * Emit the number 7, then complete\n *\n * ```ts\n * import { EMPTY, startWith } from 'rxjs';\n *\n * const result = EMPTY.pipe(startWith(7));\n * result.subscribe(x => console.log(x));\n *\n * // Outputs\n * // 7\n * ```\n *\n * Map and flatten only odd numbers to the sequence `'a'`, `'b'`, `'c'`\n *\n * ```ts\n * import { interval, mergeMap, of, EMPTY } from 'rxjs';\n *\n * const interval$ = interval(1000);\n * const result = interval$.pipe(\n * mergeMap(x => x % 2 === 1 ? of('a', 'b', 'c') : EMPTY),\n * );\n * result.subscribe(x => console.log(x));\n *\n * // Results in the following to the console:\n * // x is equal to the count on the interval, e.g. (0, 1, 2, 3, ...)\n * // x will occur every 1000ms\n * // if x % 2 is equal to 1, print a, b, c (each on its own)\n * // if x % 2 is not equal to 1, nothing will be output\n * ```\n *\n * @see {@link Observable}\n * @see {@link NEVER}\n * @see {@link of}\n * @see {@link throwError}\n */\nexport const EMPTY = new Observable((subscriber) => subscriber.complete());\n\n/**\n * @param scheduler A {@link SchedulerLike} to use for scheduling\n * the emission of the complete notification.\n * @deprecated Replaced with the {@link EMPTY} constant or {@link scheduled} (e.g. `scheduled([], scheduler)`). Will be removed in v8.\n */\nexport function empty(scheduler?: SchedulerLike) {\n return scheduler ? emptyScheduled(scheduler) : EMPTY;\n}\n\nfunction emptyScheduled(scheduler: SchedulerLike) {\n return new Observable((subscriber) => scheduler.schedule(() => subscriber.complete()));\n}\n", "import { SchedulerLike } from '../types';\nimport { isFunction } from './isFunction';\n\nexport function isScheduler(value: any): value is SchedulerLike {\n return value && isFunction(value.schedule);\n}\n", "import { SchedulerLike } from '../types';\nimport { isFunction } from './isFunction';\nimport { isScheduler } from './isScheduler';\n\nfunction last(arr: T[]): T | undefined {\n return arr[arr.length - 1];\n}\n\nexport function popResultSelector(args: any[]): ((...args: unknown[]) => unknown) | undefined {\n return isFunction(last(args)) ? args.pop() : undefined;\n}\n\nexport function popScheduler(args: any[]): SchedulerLike | undefined {\n return isScheduler(last(args)) ? args.pop() : undefined;\n}\n\nexport function popNumber(args: any[], defaultValue: number): number {\n return typeof last(args) === 'number' ? args.pop()! : defaultValue;\n}\n", "export const isArrayLike = ((x: any): x is ArrayLike => x && typeof x.length === 'number' && typeof x !== 'function');", "import { isFunction } from \"./isFunction\";\n\n/**\n * Tests to see if the object is \"thennable\".\n * @param value the object to test\n */\nexport function isPromise(value: any): value is PromiseLike {\n return isFunction(value?.then);\n}\n", "import { InteropObservable } from '../types';\nimport { observable as Symbol_observable } from '../symbol/observable';\nimport { isFunction } from './isFunction';\n\n/** Identifies an input as being Observable (but not necessary an Rx Observable) */\nexport function isInteropObservable(input: any): input is InteropObservable {\n return isFunction(input[Symbol_observable]);\n}\n", "import { isFunction } from './isFunction';\n\nexport function isAsyncIterable(obj: any): obj is AsyncIterable {\n return Symbol.asyncIterator && isFunction(obj?.[Symbol.asyncIterator]);\n}\n", "/**\n * Creates the TypeError to throw if an invalid object is passed to `from` or `scheduled`.\n * @param input The object that was passed.\n */\nexport function createInvalidObservableTypeError(input: any) {\n // TODO: We should create error codes that can be looked up, so this can be less verbose.\n return new TypeError(\n `You provided ${\n input !== null && typeof input === 'object' ? 'an invalid object' : `'${input}'`\n } where a stream was expected. You can provide an Observable, Promise, ReadableStream, Array, AsyncIterable, or Iterable.`\n );\n}\n", "export function getSymbolIterator(): symbol {\n if (typeof Symbol !== 'function' || !Symbol.iterator) {\n return '@@iterator' as any;\n }\n\n return Symbol.iterator;\n}\n\nexport const iterator = getSymbolIterator();\n", "import { iterator as Symbol_iterator } from '../symbol/iterator';\nimport { isFunction } from './isFunction';\n\n/** Identifies an input as being an Iterable */\nexport function isIterable(input: any): input is Iterable {\n return isFunction(input?.[Symbol_iterator]);\n}\n", "import { ReadableStreamLike } from '../types';\nimport { isFunction } from './isFunction';\n\nexport async function* readableStreamLikeToAsyncGenerator(readableStream: ReadableStreamLike): AsyncGenerator {\n const reader = readableStream.getReader();\n try {\n while (true) {\n const { value, done } = await reader.read();\n if (done) {\n return;\n }\n yield value!;\n }\n } finally {\n reader.releaseLock();\n }\n}\n\nexport function isReadableStreamLike(obj: any): obj is ReadableStreamLike {\n // We don't want to use instanceof checks because they would return\n // false for instances from another Realm, like an